If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: YAEALSR
Peptide within the protein Fag-e-2:
MKLFIILATATLLIAATQATYPRDEGFDLGETQMSSKCMRQVKMNEPHLKKCNRYIAMDILDDKYAEALSRVEGEGCKSEESCMRGCCVAMKEMDDECVCEWMKMMVENQKGRIGERLIKEGVRDLKELPSKCGLSELECGSRGNRYFV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide YAEALSR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Amborella trichopoda | Amborella trichopoda | XP_006856921 |
13333 |
| Aphanomyces astaci | Aphanomyces astaci | XP_009826908 |
112090 |
| Austrofundulus limnaeus | Austrofundulus limnaeus | XP_013863232 |
52670 |
| Brachypodium distachyon | Brachypodium distachyon | XP_003572831 KQK00801 |
15368 |
| Callorhinchus milii | Elephant shark | XP_007884071 |
7868 |
| Candidatus Caldiarchaeum subterraneum | Candidatus caldiarchaeum subterraneum | BAJ46960 BAJ47707 |
311458 |
| Chondrus crispus | Carragheen | XP_005718971 |
2769 |
| Ectocarpus siliculosus | Ectocarpus siliculosus | CBN74690 |
2880 |
| Environmental Halophage eHP-39 | Environmental halophage ehp-39 | AFH22958 |
1168841 |
| Exophiala spinifera | Exophiala spinifera | XP_016238513 |
91928 |
| Exophiala xenobiotica | Exophiala xenobiotica | XP_013322633 |
348802 |
| Fagopyrum esculentum | Common buckwheat | AAX57578 ABC18306 |
3617 |
| Gaeumannomyces graminis var. tritici R3-111a-1 | Gaeumannomyces graminis var. tritici r3-111a-1 | XP_009226091 |
644352 |
| Glonium stellatum | Glonium stellatum | OCL06680 |
574774 |
| Gossypium arboreum | Gossypium arboreum | XP_017605913 KHG24697 |
29729 |
| Gossypium hirsutum | Upland cotton | XP_016743300 XP_016694705 XP_016743299 XP_016694704 |
3635 |
| Gossypium raimondii | Gossypium raimondii | XP_012491783 XP_012491782 |
29730 |
| Leishmania braziliensis MHOM/BR/75/M2904 | Leishmania braziliensis mhom/br/75/m2904 | XP_001566653 |
420245 |
| Leishmania donovani | Leishmania donovani | XP_003861625 |
5661 |
| Leishmania infantum JPCM5 | Leishmania infantum jpcm5 | XP_001470384 |
435258 |
| Leishmania major strain Friedlin | Leishmania major strain friedlin | XP_001684044 |
347515 |
| Leishmania mexicana MHOM/GT/2001/U1103 | Leishmania mexicana mhom/gt/2001/u1103 | XP_003876341 |
929439 |
| Leishmania panamensis | Leishmania panamensis | XP_010701055 |
5679 |
| Leptomonas seymouri | Leptomonas seymouri | KPI83454 KPI88487 |
5684 |
| Marchantia polymorpha subsp. polymorpha | Marchantia polymorpha subsp. polymorpha | OAE19890 |
1480153 |
| Mucor circinelloides f. lusitanicus CBS 277.49 | Mucor circinelloides f. lusitanicus cbs 277.49 | OAD06215 |
747725 |
| Nelumbo nucifera | Nelumbo nucifera | XP_010268556 |
4432 |
| Peniophora sp. CONT | Peniophora sp. cont | KZV72480 |
1314672 |
| Phanerochaete carnosa HHB-10118-sp | Phanerochaete carnosa hhb-10118-sp | XP_007400554 |
650164 |
| Pyrenophora tritici-repentis Pt-1C-BFP | Pyrenophora tritici-repentis pt-1c-bfp | XP_001932812 |
426418 |
| Pyrococcus yayanosii | Pyrococcus yayanosii | WP_013905995 |
1008460 |
| Pyrococcus yayanosii CH1 | Pyrococcus yayanosii ch1 | WP_013905995 |
529709 |
| Scleropages formosus | Asian bonytongue | KPP57758 |
113540 |
| Setaria italica | Foxtail millet | XP_004962329 |
4555 |
| Spizellomyces punctatus DAOM BR117 | Spizellomyces punctatus daom br117 | XP_016610359 |
645134 |
| Stomoxys calcitrans | Stable fly | XP_013097606 |
35570 |
| Talaromyces marneffei PM1 | Talaromyces marneffei pm1 | KFX40848 |
1077442 |
| Termitomyces sp. J132 | Termitomyces sp. j132 | KNZ77979 |
1306850 |
| Zea mays | Zea mays | AFW77663 XP_008649524 XP_008649523 |
4577 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.