If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AADSFNHK
Peptide within the protein Cyp-c-1:
Isoform: Cyp-c-1.0101
MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA
Isoform: Cyp-c-1.0201
MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIEEDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AADSFNHK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Anolis carolinensis | Green anole | XP_008108861 |
28377 |
| Apteryx australis mantelli | Apteryx australis mantelli | XP_013806360 |
202946 |
| Carassius auratus | Goldfish | AET79255 |
7957 |
| Cyprinus carpio | Common carp | 1B8C_A P02618 1B8R_A 1B9A_A 1CDP_A CBA35344 CAC83659 KTG35550 KTG43301 |
7962 |
| Danio rerio | Zebrafish | AAO33402 NP_997948 |
7955 |
| Esox lucius | Northern pike | XP_010862297 |
8010 |
| Hypophthalmichthys molitrix | Silver carp | ACI95745 AGH28007 |
13095 |
| Kryptolebias marmoratus | Mangrove rivulus | XP_017272259 |
37003 |
| Nothobranchius furzeri | Turquoise killifish | XP_015819053 |
105023 |
| Notothenia coriiceps | Black rockcod | XP_010767863 |
8208 |
| Oncorhynchus mykiss | Rainbow trout | P86432 CDQ73484 NP_001182340 AAN10126 CDQ72564 |
8022 |
| Salmo salar | Atlantic salmon | NP_001182340 NP_001117189 NP_001133167 XP_014064375 |
8030 |
| Salvelinus alpinus | Arctic char | AAN10126 |
8036 |
| Salvelinus fontinalis | Brook trout | NP_001182340 |
8038 |
| Siniperca chuatsi | Mandarin fish | AET79257 |
119488 |
| Sinocyclocheilus anshuiensis | Sinocyclocheilus anshuiensis | XP_016345216 |
1608454 |
| Sinocyclocheilus grahami | Sinocyclocheilus grahami | XP_016106650 XP_016106649 |
75366 |
| Sinocyclocheilus rhinocerous | Sinocyclocheilus rhinocerous | XP_016345216 |
307959 |
| Squalius cephalus | European chub | P05939 |
8284 |
| Takifugu rubripes | Torafugu | XP_011602756 |
31033 |
| Tetraodon nigroviridis | Spotted green pufferfish | CAG04448 |
99883 |
| Xenopus laevis | African clawed frog | NP_001090579 NP_001087327 |
8355 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.