If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: IGVDEFTALVK
Peptide within the protein Cyp-c-1:
Isoform: Cyp-c-1.0101
MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKA
Isoform: Cyp-c-1.0201
MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIEEDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide IGVDEFTALVK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Acanthopagrus schlegelii | Black porgy | AEW90931 |
72011 |
| Carassius auratus | Goldfish | AET79255 |
7957 |
| Cyprinus carpio | Common carp | P02618 1CDP_A CBA35344 CAC83659 |
7962 |
| Girella punctata | Largescale blackfish | AEW90931 |
163149 |
| Oplegnathus fasciatus | Barred knifejaw | AEW90931 |
163134 |
| Oreochromis niloticus | Nile tilapia | XP_003443184 |
8128 |
| Oryzias latipes | Japanese medaka | XP_004071813 |
8090 |
| Pagrus major | Red seabream | AEW90933 |
143350 |
| Paralichthys olivaceus | Japanese flounder | AEW90931 |
8255 |
| Platichthys stellatus | Starry flounder | AEW90931 |
195632 |
| Scomber japonicus | Chub mackerel | AEW90938 |
13676 |
| Sebastes inermis | Sebastes inermis | ABD24011 |
160818 |
| Sebastes schlegelii | Schlegel's black rockfish | AEW90931 |
214486 |
| Trachurus japonicus | Japanese jack mackerel | AEW90938 |
83875 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.