Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MAMAGVFVLFSFVLCGFLPDAAFGAEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
None.
Species containing the peptide CNFCNAVVESNGTLTLSHFGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Alectoris chukar | Chukar partridge | P68146 |
9078 |
| Acryllium vulturinum | Vulturine guineafowl | P68468 |
8992 |
| Afropavo congensis | Congo peafowl | P52258 |
9076 |
| Alectoris rufa | Red-legged partridge | P68146 |
9079 |
| Arborophila torqueola | Hill partridge | P05601 |
9105 |
| Bonasa umbellus | Ruffed grouse | P67944 |
9000 |
| Callipepla californica | California quail | P68387 |
67771 |
| Callipepla gambelii | Gambel's quail | P68387 |
67773 |
| Callipepla squamata castanogastris | Chestnut-bellied scaled quail | P05589 |
9010 |
| Callipepla squamata pallida | Blue scaled quail | P05588 |
9011 |
| Catreus wallichii | Cheer pheasant | P67944 |
9085 |
| Centrocercus urophasianus | Greater sage-grouse | P67944 |
9002 |
| Colinus virginianus | Northern bobwhite | P05591 |
9014 |
| Crossoptilon auritum | Blue eared-pheasant | P67944 |
9096 |
| Crossoptilon crossoptilon | White-eared pheasant | P52245 |
30408 |
| Crossoptilon mantchuricum | Brown eared-pheasant | P67944 |
9097 |
| Cyrtonyx montezumae | Montezuma quail | P05592 |
9017 |
| Francolinus pondicerianus | Gray francolin | P05598 |
9019 |
| Gallus gallus | Chicken | AAA48995 0807280A NP_001106132 NP_001295423 ACJ04729 |
9031 |
| Gallus lafayetii | Ceylon junglefowl | E31438 |
9032 |
| Gallus sonneratii | Gray junglefowl | E31438 E31440 |
9033 |
| Gallus varius | Green junglefowl | P52267 |
9034 |
| Guttera pucherani | Kenya guineafowl | P52260 |
8994 |
| Lagopus leucura | White-tailed ptarmigan | P67944 |
30410 |
| Lophophorus impejanus | Lophophorus impejanus | P67944 |
9040 |
| Lophura bulweri | Bulwer's pheasant | P52261 |
9042 |
| Lophura diardi | Lophura diardi | P67893 |
30402 |
| Lophura edwardsi | Edwards's pheasant | P67944 |
9043 |
| Lophura ignita | Crested fireback pheasant | P67893 |
9044 |
| Lophura leucomelanos | Lophura leucomelanos | P52262 |
140445 |
| Lophura nycthemera | Silver pheasant | 1IY5_A P67944 4OVO_A |
9046 |
| Lophura swinhoii | Lophura swinhoii | P67944 |
140446 |
| Meleagris gallopavo | Turkey | 2GKT_I 1SGE_I 1SGD_I 1SGN_I 1SGY_I 2SGQ_I 2SGF_I 1CT4_I 1DS2_I 1SGP_I 1SGQ_I 1CSO_I 1HJA_I 1SGR_I 2SGP_I 1CT0_I 1CT2_I 1DS3_I 2NU2_I 2NU0_I 2NU1_I P52245 P68390 XP_010717310 XP_003210408 |
9103 |
| Meleagris ocellata | Ocellated turkey | 1M8B_A P52245 |
9101 |
| Numida meleagris | Helmeted guineafowl | P68468 |
8996 |
| Oreortyx pictus | Mountain quail | P05587 |
9029 |
| Pavo cristatus | Indian peafowl | P05609 |
9049 |
| Pavo muticus | Green peafowl | P52263 |
9050 |
| Pucrasia macrolopha | Pucrasia macrolopha | P67944 |
9061 |
| Syrmaticus ellioti | Elliot's pheasant | P67944 |
9063 |
| Syrmaticus humiae | Hume's pheasant | P67944 |
9064 |
| Syrmaticus soemmerringii | Copper pheasant | P67944 |
9067 |
| Tragopan blythii | Tragopan blythii | P67944 |
30406 |
| Tragopan caboti | Tragopan caboti | P67944 |
30407 |
| Tragopan satyra | Tragopan satyra | P67944 |
9070 |
| Tragopan temminckii | Tragopan temminckii | P67944 |
9071 |
| Tympanuchus cupido | Greater prairie chicken | P67944 |
9004 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.