If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: DVLVCNK
Peptide within the protein Gal-d-1:
MAMAGVFVLFSFVLCGFLPDAAFGAEVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide DVLVCNK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Callorhinchus milii | Elephant shark | XP_007893000 |
7868 |
| Capsaspora owczarzaki ATCC 30864 | Capsaspora owczarzaki atcc 30864 | KJE95918 XP_011270649 |
595528 |
| Gallus gallus | Chicken | 0807280A NP_001106132 NP_001295423 ACJ04729 |
9031 |
| Plasmodium falciparum | Malaria parasite p. falciparum | SBT31183 |
5833 |
| Plasmodium ovale curtisi | Plasmodium ovale curtisi | SBS80254 SBS80935 |
864141 |
| Plasmodium ovale wallikeri | Plasmodium ovale wallikeri | SBT31183 SBT31771 |
864142 |
| Vitrella brassicaformis CCMP3155 | Vitrella brassicaformis ccmp3155 | CEM26639 |
1169540 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.