If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: CELAAAMK
Peptide within the protein Gal-d-4:
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
References reporting this peptide:
- Cryar A., et al. Towards absolute quantification of allergenic proteins in food--lysozyme in wine as a model system for metrologically traceable mass spectrometric methods and certified reference materials.. Journal of AOAC International. 2013
Species Uniqueness
Species containing the peptide CELAAAMK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aix sponsa | Wood duck | Q7LZQ2 |
8833 |
| Alligator mississippiensis | American alligator | XP_006267124 |
8496 |
| Alligator sinensis | Chinese alligator | XP_006027022 |
38654 |
| Anas platyrhynchos | Mallard | EOB09190 0802160B 0802160A P00706 XP_005008937 P00705 |
8839 |
| Anser cygnoides domesticus | Anser cygnoides domesticus | XP_013053649 |
381198 |
| Apteryx australis mantelli | Apteryx australis mantelli | XP_013802731 XP_013802729 |
202946 |
| Bambusicola thoracica | Chinese bamboo-partridge | ACL81751 |
9083 |
| Callipepla californica | California quail | P00699 |
67771 |
| Catreus wallichii | Cheer pheasant | Q7LZP9 |
9085 |
| Chrysolophus amherstiae | Lady amherst's pheasant | P22910 |
9088 |
| Chrysolophus pictus | Golden pheasant | P22910 |
9089 |
| Colinus virginianus | Northern bobwhite | P00700 |
9014 |
| Coturnix japonica | Japanese quail | 2IHL_A XP_015711651 P00701 |
93934 |
| Crax fasciolata | Crax fasciolata | Q7LZQ3 |
84988 |
| Dromaius novaehollandiae | Emu | G3XDT7 |
8790 |
| Francolinus pondicerianus interpositus | Francolinus pondicerianus interpositus | ACL81753 |
588856 |
| Gallus gallus | Chicken | AAD10202 3ZVQ_A 1UIA_A 5HMV_A 1V7S_A 1NDG_C 1H6M_A 1LSN_A 1LZG_A 1UIC_A 1IR9_A 630460A 1UIE_A 1FLW_A 1NBY_C 1FLY_A 1AT5_A 1AT6_A 1HEP_A 1IR8_A 1KXY_A 1FLQ_A 1FN5_A 1KXW_A 1A2Y_C 1HER_A 1HEO_A 1HEQ_A 1HEN_A 1NBZ_C 2IFF_Y 3WW6_A 3WW5_A 3WVX_A 4YEO_A 3A3Q_A 1IR7_A 1LZD_A 1FDL_Y 1IO5_A 1HEM_A 1UIF_A 1UID_A 1KXX_A 1FLU_A 1LSM_A 3QY4_A 3OK0_A 3OJP_A 4MWN_A 1LSG_A 1LSY_A ACL81619 ACL81573 ACL81571 P00698 NP_990612 |
9031 |
| Gallus lafayetii | Ceylon junglefowl | P00698 |
9032 |
| Gallus sonneratii | Gray junglefowl | P00698 |
9033 |
| Gallus varius | Green junglefowl | ACL81755 |
9034 |
| Gavia stellata | Gavia stellata | XP_009814321 |
37040 |
| Lophophorus impejanus | Lophophorus impejanus | Q7LZP9 |
9040 |
| Lophura leucomelanos | Lophura leucomelanos | P24364 |
140445 |
| Meleagris gallopavo | Turkey | 1DZB_X 1LZ2_A XP_003202118 |
9103 |
| Numida meleagris | Helmeted guineafowl | P00704 1HHL_A |
8996 |
| Ortalis vetula | Plain chachalaca | P00707 |
8984 |
| Pavo cristatus | Indian peafowl | P19849 |
9049 |
| Phasianus colchicus | Ring-necked pheasant | 1JHL_A 1GHL_A LZFER |
9054 |
| Phasianus colchicus colchicus | Ring-necked pheasant | P00702 |
9057 |
| Phasianus versicolor | Green pheasant | P49663 |
9055 |
| Struthio camelus | African ostrich | XP_009670021 |
8801 |
| Struthio camelus australis | Struthio camelus australis | XP_009670021 |
441894 |
| Syrmaticus reevesii | Reeves's pheasant | P24533 |
9066 |
| Syrmaticus soemmerringii | Copper pheasant | P81711 2011187A |
9067 |
| Tinamus guttatus | Tinamus guttatus | XP_010209345 |
94827 |
| Tragopan satyra | Tragopan satyra | Q7LZI3 |
9070 |
| Tragopan temminckii | Tragopan temminckii | Q7LZT2 |
9071 |
| Tympanuchus cupido | Greater prairie chicken | ANZ02901 |
9004 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.