If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: FESNFNTQATNR
Peptide within the protein Gal-d-4:
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
References reporting this peptide:
- Cryar A., et al. Towards absolute quantification of allergenic proteins in food--lysozyme in wine as a model system for metrologically traceable mass spectrometric methods and certified reference materials.. Journal of AOAC International. 2013
- Gavage, et al. Selection of egg peptide biomarkers in processed food products by high resolution mass spectrometry. Journal of Chromatography A. 2019
- Monaci L., et al. Multi-allergen quantification of fining-related egg and milk proteins in white wines by high-resolution mass spectrometry. Rapid Communications in Mass Spectrometry. 2013
- Montowska, et al. Detection of peptide markers of soy, milk and egg white allergenic proteins in poultry products by LC-Q-TOF-MS/MS. LWT - Food Science and Technology. 2018
- Parker, et al. Multi-allergen Quantitation and the Impact of Thermal Treatment in Industry-Processed Baked Goods by ELISA and Liquid Chromatography-Tandem Mass Spectrometry.. Journal of Agricultural and Food Chemistry. 2015
- Pilolli, et al. Orbitrap™ monostage MS versus hybrid linear ion trap MS: application to multi-allergen screening in wine.. Journal of Mass Spectrometry. 2014
- Tolin S., et al. Analysis of commercial wines by LC-MS/MS reveals the presence of residual milk and egg white allergens. Food Control. 2012
Species Uniqueness
Species containing the peptide FESNFNTQATNR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Coturnix japonica | Japanese quail | 2IHL_A XP_015711651 P00701 |
93934 |
| Gallus gallus | Chicken | 3OTP_G 3ZVQ_A 1UIA_A 5HMV_A 1V7S_A 1NDG_C 1LSN_A 1LZG_A 1UIC_A 1IR9_A 630460A 1UIE_A 1FLW_A 1NBY_C 1FLY_A 1AT5_A 1AT6_A 1IOS_A 1IR8_A 1KXY_A 1FLQ_A 1IOQ_A 1FN5_A 1KXW_A 1IOT_A 1A2Y_C 1HEO_A 1HEN_A 1IOR_A 1NBZ_C 2IFF_Y 3WW6_A 3WW5_A 3WVX_A 4YEO_A 4N0J_A 3A3Q_A 1IR7_A 1LZD_A 1FDL_Y 1IO5_A 1HEM_A 1UIF_A 1UID_A 1KXX_A 1FLU_A 1LSM_A 3QY4_A 3OJP_A 132L_A 4MWN_A 1LSG_A 1LSY_A ACL81619 ACL81573 ACL81571 P00698 NP_990612 |
9031 |
| Gallus lafayetii | Ceylon junglefowl | P00698 |
9032 |
| Gallus sonneratii | Gray junglefowl | P00698 |
9033 |
| Rattus norvegicus | Norway rat | A61281 |
10116 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.