If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NTDGSTDYGILQINSR
Peptide within the protein Gal-d-4:
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
References reporting this peptide:
- Lee J.Yun, et al. Determination of Allergenic Egg Proteins in Food by Protein-, Mass Spectrometry-, and DNA-Based Methods. Journal of AOAC International. 2010
- Monaci L., et al. Multi-allergen quantification of fining-related egg and milk proteins in white wines by high-resolution mass spectrometry. Rapid Communications in Mass Spectrometry. 2013
- Montowska, et al. Detection of peptide markers of soy, milk and egg white allergenic proteins in poultry products by LC-Q-TOF-MS/MS. LWT - Food Science and Technology. 2018
- Parker, et al. Multi-allergen Quantitation and the Impact of Thermal Treatment in Industry-Processed Baked Goods by ELISA and Liquid Chromatography-Tandem Mass Spectrometry.. Journal of Agricultural and Food Chemistry. 2015
- Pilolli, et al. Orbitrap™ monostage MS versus hybrid linear ion trap MS: application to multi-allergen screening in wine.. Journal of Mass Spectrometry. 2014
- Tolin S., et al. Analysis of commercial wines by LC-MS/MS reveals the presence of residual milk and egg white allergens. Food Control. 2012
Species Uniqueness
Species containing the peptide NTDGSTDYGILQINSR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Anas platyrhynchos | Mallard | EOB09190 0802160B 0802160A XP_005008937 P00705 |
8839 |
| Catreus wallichii | Cheer pheasant | Q7LZP9 |
9085 |
| Chrysolophus amherstiae | Lady amherst's pheasant | P22910 |
9088 |
| Chrysolophus pictus | Golden pheasant | P22910 |
9089 |
| Coturnix japonica | Japanese quail | 2IHL_A XP_015711651 P00701 |
93934 |
| Gallus gallus | Chicken | 3ZVQ_A 1UIA_A 5HMV_A 1V7S_A 1H6M_A 1LSN_A 1LZG_A 1UIC_A 1IR9_A 630460A 1UIE_A 1FLW_A 1NBY_C 1FLY_A 1AT5_A 1AT6_A 1IOS_A 1KXY_A 1FLQ_A 1KXW_A 1IOT_A 1A2Y_C 1HER_A 1HEQ_A 1NBZ_C 2IFF_Y 4YEO_A 4N0J_A 1IR7_A 1LZD_A 1FDL_Y 1IO5_A 1HEM_A 1UIF_A 1UID_A 1KXX_A 1FLU_A 3QY4_A 3OK0_A 132L_A 4MWN_A 1LSG_A P00698 NP_990612 |
9031 |
| Gallus lafayetii | Ceylon junglefowl | P00698 |
9032 |
| Gallus sonneratii | Gray junglefowl | P00698 |
9033 |
| Lophophorus impejanus | Lophophorus impejanus | Q7LZP9 |
9040 |
| Lophura leucomelanos | Lophura leucomelanos | P24364 |
140445 |
| Meleagris gallopavo | Turkey | 1DZB_X XP_003202118 |
9103 |
| Oplegnathus fasciatus | Barred knifejaw | ADZ44620 |
163134 |
| Pavo cristatus | Indian peafowl | P19849 |
9049 |
| Phasianus colchicus | Ring-necked pheasant | 1JHL_A 1GHL_A LZFER |
9054 |
| Phasianus colchicus colchicus | Ring-necked pheasant | P00702 |
9057 |
| Phasianus versicolor | Green pheasant | P49663 |
9055 |
| Rattus norvegicus | Norway rat | A61281 |
10116 |
| Syrmaticus reevesii | Reeves's pheasant | P24533 |
9066 |
| Syrmaticus soemmerringii | Copper pheasant | P81711 2011187A |
9067 |
| Tachyglossus aculeatus | Australian echidna | P37156 |
9261 |
| Tachyglossus aculeatus aculeatus | Tachyglossus aculeatus aculeatus | P37156 |
49271 |
| Tragopan satyra | Tragopan satyra | Q7LZI3 |
9070 |
| Tragopan temminckii | Tragopan temminckii | Q7LZT2 |
9071 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.