If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Hazelnut Protein: Cor a 1 | Pathogenesis-Related Protein, Pr-10, Bet V 1 Family Member

Isoform:

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 160 amino acids

MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN

UniProt: Q08407-1   IUIS: Cor a 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 160 amino acids

MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN

UniProt: Q08407-2   IUIS: Cor a 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 160 amino acids

MGVFNYEAETTSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEIKGAKEMAEKLLRAVETYLLAHSAEYN

UniProt: Q08407-3   IUIS: Cor a 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 160 amino acids

MGVFNYEVETPSVISAARLFKSYVLDGDKLIPKVAPQAITSVENVGGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFKYSYTVIEGDVLGDKLEKVCSELKIVAAPGGGSTLKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN

UniProt: Q08407-4   IUIS: Cor a 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 160 amino acids

MGVFNYETESTSVIPAARLFKAFILDGNNLIPKVAPQAVSSVENVEGNGGPGTIKKITFSEGSPFKYVKERVEEVDHTNFKYSYTVIEGGPVGDKVEKICNEIKIVAAPDGGSILKISNKYHTKGDHEVDAEHIKGGKEKVEGLFRAVEAYLLAHSDAYN

UniProt: Q39453   IUIS: Cor a 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 160 amino acids

MGVFNYETETTSVIPPARLFKRFVLDSDNLIPKVAPKAIKSIEIIEGNGGPGTIKKICFDEGSPFNYIKQKVEEIDQANFSYRYSVIEGDALSDKLEKINYEIKIVASPHGGSILKSISKYHTIGDHELKDEQIKAGKEKASGLFKAVEGYLLAHSDAYN

UniProt: Q39454   IUIS: Cor a 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 161 amino acids

MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSKYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAYC

UniProt: Q9SWR4   IUIS: Cor a 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 161 amino acids

MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTYC

UniProt: Q9FPK4   IUIS: Cor a 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 161 amino acids

MGVFCYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTGAENLEGNGGPGTIKKITFAEGSEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKISYEIKMAAAPHGGGSILKITSKYHTKGNASISEEEIKAGKEKAAGLFKAVEAYLLAHPDTYC

UniProt: Q9FPK3   IUIS: Cor a 1

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 161 amino acids

MGVFSYEDEATSVIPPARLFKSFVLDADNLIPKVAPQHFTSAENLEGNGGPGTIKKITFAEGNEFKYMKHKVEEIDHANFKYCYSIIEGGPLGHTLEKIPYEIKMAAAPHGGGSILKITSKYHTKGNASINEEEIKAGKEKAAGLFKAVEAYLLAHPDAYC

UniProt: Q9FPK2   IUIS: Cor a 1

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1 Peptide 2 Exp.3 ESP4 CONSeQ5
^ MGVFNYEVETPSVIPAAR L 0 0.771 0.21982
K SYVLDGDK L 0 0.262 0.47546
K VAPQAITSVENVEGNGGPGTIK N 0 0.824 0.56582
K NITFGEGSR Y 0 0.38 0.68328
R VDEVDNTNFTYSYTVIEGDVLGDK L 0 0.46 0.08288
K IVAAPGGGSILK I 0 0.561 0.76784
K GDHEINAEEMK G 0 0.337 0.28036
R AVETYLLAHSAEYN $ 0 0.517 0.43132
R VDEVDNTNFK Y 0 0.519 0.52528
K YSYTVIEGDVLGDK L 0 0.569 0.6266
^ MGVFNYEAETTSVIPAAR L 0 0.697 0.2342
K GDHEINAEEIK G 0 0.473 0.3594
^ MGVFNYEVETPSVISAAR L 0 0.627 0.18564
K VAPQAITSVENVGGNGGPGTIK N 0 0.805 0.57174
K IVAAPGGGSTLK I 0 0.52 0.80016
^ MGVFNYETESTSVIPAAR L 0 0.68 0.25652
K AFILDGNNLIPK V 0 0.754 0.59892
K VAPQAVSSVENVEGNGGPGTIK K 0 0.777 0.637
K ITFSEGSPFK Y 0 0.506 0.76858
R VEEVDHTNFK Y 0 0.51 0.2856
K YSYTVIEGGPVGDK V 0 0.663 0.72984
K IVAAPDGGSILK I 0 0.62 0.92616
K GDHEVDAEHIK G 0 0.465 0.25798
R AVEAYLLAHSDAYN $ 0 0.494 0.5151
^ MGVFNYETETTSVIPPAR L 0 0.843 0.22548
R FVLDSDNLIPK V 0 0.736 0.6684
K SIEIIEGNGGPGTIK K 0 0.666 0.70032
K ICFDEGSPFNYIK Q 0 0.649 0.25266
K VEEIDQANFSYR Y 0 0.636 0.57546
R YSVIEGDALSDK L 0 0.604 0.82864
K IVASPHGGSILK S 0 0.667 0.7551
K YHTIGDHELK D 0 0.481 0.15548
K AVEGYLLAHSDAYN $ 0 0.559 0.54094
^ MGVFCYEDEATSVIPPAR L 0 0.743 0.21746
K SFVLDADNLIPK V 0 0.817 0.74652
K VAPQHFTSAENLEGNGGPGTIK K 0 0.887 0.66972
K ITFAEGNEFK Y 0 0.503 0.56426
K VEEIDHANFK Y 0 0.541 0.33356
K YCYSIIEGGPLGHTLEK I 0 0.684 0.23458
K MAAAPHGGGSILK I 0 0.517 0.57064
K GNASINEEEIK A 0 0.408 0.5519
K AVEAYLLAHPDAYC $ 0 0.588 0.34476
^ MGVFSYEDEATSVIPPAR L 0 0.807 0.33254
K VAPQHFTGAENLEGNGGPGTIK K 0 0.884 0.64972
K ITFAEGSEFK Y 0 0.451 0.62208
K GNASISEEEIK A 0 0.395 0.67118
K AVEAYLLAHPDTYC $ 0 0.633 0.32554

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.