If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GIAGLNPNLAAGLPGK
Peptide within the protein Cor-a-8:
MGSLKLVCAVLLCMMVAAPVARASLTCPQIKGNLTPCVLYLKNGGVLPPSCCKGVRAVNDASRTTSDRQSACNCLKDTAKGIAGLNPNLAAGLPGKCGVNIPYKISPSTNCNNVK
References reporting this peptide:
- Ansari P., et al. Marker peptide selection for the determination of hazelnut by LC–MS/MS and occurrence in other nuts. Analytical and Bioanalytical Chemistry. 2012
- Costa J., et al. Assessing hazelnut allergens by protein- and DNA-based approaches: LC-MS/MS, ELISA and real-time PCR. Analytical and Bioanalytical Chemistry. 2014
Species Uniqueness
Species containing the peptide GIAGLNPNLAAGLPGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Corylus avellana | Corylus avellana | 4XUW_A AAK28533 |
13451 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.