Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: NAAAGVSGLNAGNAASIPSK
Peptide within the protein Zea-m-14:
MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRYSRRMHASAD
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide NAAAGVSGLNAGNAASIPSK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Zea diploperennis | Zea diploperennis | ABA33860 ABA33862 ABA33866 ABA33859 ABA33867 ABA33860 ABA33862 ABA33866 ABA33859 ABA33867 |
4576 |
| Zea mays | Zea mays | 1FK0_A JH0379 ACG40474 P19656 NP_001297146 1FK0_A JH0379 ACG40474 P19656 NP_001297146 |
4577 |
| Zea mays subsp. parviglumis | Zea mays subsp. parviglumis | ABA33853 ABA33848 ABA33858 ABA33856 ABA33849 ABA33847 ABA33850 ABA33846 ABA33857 P19656 ABA33855 ABA33854 ABA33853 ABA33848 ABA33858 ABA33856 ABA33849 ABA33847 ABA33850 ABA33846 ABA33857 P19656 ABA33855 ABA33854 |
76912 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.