Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SLNNAAR
Peptide within the protein Zea-m-14:
MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
MARTQQLAVVATAVVALVLLAAATSEAAISCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRYSRRMHASAD
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SLNNAAR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Dimocarpus longan | Dimocarpus longan | AEC04836 AEC04836 |
128017 |
| Eucalyptus grandis | Eucalyptus grandis | XP_010043178 XP_010035998 XP_010043178 XP_010035998 |
71139 |
| Exaiptasia pallida | Exaiptasia pallida | KXJ27015 KXJ27015 |
1720309 |
| Hypsizygus marmoreus | Hypsizygus marmoreus | KYQ35634 KYQ35634 |
39966 |
| Larimichthys crocea | Large yellow croaker | KKF15780 KKF15780 |
215358 |
| Nasonia vitripennis | Jewel wasp | XP_001604355 XP_001604355 |
7425 |
| Plasmopara halstedii | Plasmopara halstedii | CEG42724 CEG42724 |
4781 |
| Pleurotus ostreatus PC15 | Pleurotus ostreatus pc15 | KDQ30097 KDQ30097 |
1137138 |
| Arthroderma otae CBS 113480 | Arthroderma otae cbs 113480 | XP_002843218 XP_002843218 |
554155 |
| Aspergillus oryzae 100-8 | Aspergillus oryzae 100-8 | EIT74995 EIT74995 |
1197718 |
| Aspergillus oryzae 3.042 | Aspergillus oryzae 3.042 | EIT74995 EIT74995 |
1160506 |
| Aspergillus oryzae RIB40 | Aspergillus oryzae rib40 | BAE58939 BAE58939 |
510516 |
| Byssochlamys spectabilis No. 5 | Byssochlamys spectabilis no. 5 | GAD97056 GAD97056 |
1356009 |
| Cynara cardunculus var. scolymus | Cynara cardunculus var. scolymus | KVI06627 KVI06627 |
59895 |
| Lucilia cuprina | Australian sheep blowfly | KNC32747 KNC32120 KNC32747 KNC32120 |
7375 |
| Manihot esculenta | Cassava | OAY32406 OAY32406 |
3983 |
| Myceliophthora thermophila ATCC 42464 | Myceliophthora thermophila atcc 42464 | XP_003662632 XP_003662632 |
573729 |
| Setaria italica | Foxtail millet | KQK99666 NP_001274465 KQK99666 NP_001274465 |
4555 |
| Tetrapisispora phaffii CBS 4417 | Tetrapisispora phaffii cbs 4417 | XP_003687134 XP_003687134 |
1071381 |
| Trifolium subterraneum | Trifolium subterraneum | GAU30834 GAU30834 |
3900 |
| Zea diploperennis | Zea diploperennis | ABA33860 ABA33862 ABA33866 ABA33859 ABA33867 ABA33860 ABA33862 ABA33866 ABA33859 ABA33867 |
4576 |
| Zea mays | Zea mays | 1FK0_A JH0379 ACG40474 P19656 NP_001297146 1FK0_A JH0379 ACG40474 P19656 NP_001297146 |
4577 |
| Zea mays subsp. parviglumis | Zea mays subsp. parviglumis | ABA33853 ABA33848 ABA33858 ABA33856 ABA33849 ABA33847 ABA33850 ABA33846 ABA33857 P19656 ABA33855 ABA33853 ABA33848 ABA33858 ABA33856 ABA33849 ABA33847 ABA33850 ABA33846 ABA33857 P19656 ABA33855 |
76912 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.