If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LELHMAS
Peptide within the protein Zea-m-25:
MAASEAAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELHMAS
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide LELHMAS are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Astyanax mexicanus | Mexican tetra | XP_015460546 |
7994 |
| Ictalurus punctatus | Channel catfish | XP_017342669 XP_017342668 XP_017342667 XP_017342666 XP_017342665 XP_017342663 |
7998 |
| Polistes canadensis | Polistes canadensis | XP_014597796 |
91411 |
| Polistes dominula | Polistes dominula | XP_015183050 XP_015183049 XP_015183048 |
743375 |
| Pygocentrus nattereri | Red-bellied piranha | XP_017565205 XP_017565198 XP_017565180 |
42514 |
| Reticulomyxa filosa | Reticulomyxa filosa | ETO10857 |
46433 |
| Trypanosoma cruzi | Trypanosoma cruzi | EKG04785 |
5693 |
| Trypanosoma cruzi Dm28c | Trypanosoma cruzi dm28c | ESS66315 |
1416333 |
| Zea mays | Zea mays | ACG31323 ACG24448 NP_001105788 ACG24509 ACG44359 ACG41127 |
4577 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.