If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LVVIDFTATWCPPCR
Peptide within the protein Zea-m-25:
MAASEAAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELHMAS
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide LVVIDFTATWCPPCR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Brassica rapa | Field mustard | XP_009129553 |
3711 |
| Cleome hassleriana | Cleome hassleriana | XP_010538107 |
28532 |
| Sorghum bicolor | Sorghum | XP_002440041 KXG22303 |
4558 |
| Zea mays | Zea mays | AFW78616 ACG31323 ACG24448 NP_001105788 ACG24509 ACG44359 ACG41127 ACG35158 |
4577 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.