If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SPNVVFLK
Peptide within the protein Zea-m-25:
MAASEAAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELHMAS
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SPNVVFLK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Trichinella sp. T9 | Trichinella sp. t9 | KRX58989 |
181606 |
| Zea mays | Zea mays | AFW78616 ACG31323 ACG24448 NP_001105788 ACG24509 ACG44359 ACG41127 |
4577 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.