If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VDVDEMK
Peptide within the protein Zea-m-25:
MAASEAAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMAPIFADMAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELARKLELHMAS
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide VDVDEMK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Cladophialophora yegresii CBS 114405 | Cladophialophora yegresii cbs 114405 | XP_007752790 |
1182544 |
| Capronia coronata CBS 617.96 | Capronia coronata cbs 617.96 | XP_007719758 |
1182541 |
| Capronia epimyces CBS 606.96 | Capronia epimyces cbs 606.96 | XP_007730980 |
1182542 |
| Cladophialophora bantiana CBS 173.52 | Cladophialophora bantiana cbs 173.52 | XP_016622525 |
1442370 |
| Cladophialophora carrionii | Cladophialophora carrionii | OCT53658 |
86049 |
| Cladophialophora carrionii CBS 160.54 | Cladophialophora carrionii cbs 160.54 | XP_008722230 |
1279043 |
| Cladophialophora immunda | Cladophialophora immunda | XP_016244585 |
569365 |
| Cladophialophora psammophila CBS 110553 | Cladophialophora psammophila cbs 110553 | XP_007750520 |
1182543 |
| Drechmeria coniospora | Drechmeria coniospora | ODA78475 KYK59668 |
98403 |
| Elaeis guineensis | African oil palm | XP_010936412 |
51953 |
| Exophiala aquamarina CBS 119918 | Exophiala aquamarina cbs 119918 | XP_013262846 |
1182545 |
| Fonsecaea erecta | Fonsecaea erecta | OAP59044 |
1367422 |
| Fonsecaea multimorphosa | Fonsecaea multimorphosa | XP_016629877 |
979981 |
| Fonsecaea multimorphosa CBS 102226 | Fonsecaea multimorphosa cbs 102226 | XP_016629877 |
1442371 |
| Leishmania braziliensis MHOM/BR/75/M2904 | Leishmania braziliensis mhom/br/75/m2904 | XP_001566403 |
420245 |
| Leishmania donovani | Leishmania donovani | XP_001466551 |
5661 |
| Leishmania infantum JPCM5 | Leishmania infantum jpcm5 | XP_001466551 |
435258 |
| Leishmania major strain Friedlin | Leishmania major strain friedlin | XP_003722103 |
347515 |
| Leishmania mexicana MHOM/GT/2001/U1103 | Leishmania mexicana mhom/gt/2001/u1103 | XP_003872533 |
929439 |
| Leishmania panamensis | Leishmania panamensis | XP_010700922 |
5679 |
| Rhinocladiella mackenziei CBS 650.93 | Rhinocladiella mackenziei cbs 650.93 | XP_013273232 |
1442369 |
| Sclerotinia sclerotiorum 1980 UF-70 | Sclerotinia sclerotiorum 1980 uf-70 | XP_001591308 |
665079 |
| Setaria italica | Foxtail millet | KQL14813 XP_004961572 |
4555 |
| Sorghum bicolor | Sorghum | XP_002440041 KXG22303 |
4558 |
| Trifolium subterraneum | Trifolium subterraneum | GAU44257 GAU28982 |
3900 |
| Xylona heveae TC161 | Xylona heveae tc161 | KZF20118 |
1328760 |
| Zea mays | Zea mays | AFW78616 ACG31323 ACG24448 NP_001105788 ACG24509 ACG44359 ACG41127 |
4577 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.