If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AALDGCAAADSFDYK
Peptide within the protein Lep-w-1:
MTFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRSK
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AALDGCAAADSFDYK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Cyprinodon variegatus | Cyprinodon variegatus | XP_012727819 |
28743 |
| Fundulus heteroclitus | Mummichog | XP_012727819 |
8078 |
| Haplochromis burtoni | Burton's mouthbrooder | XP_005734654 |
8153 |
| Lepidorhombus whiffiagonis | Megrim | CAP17694 |
154550 |
| Maylandia zebra | Zebra mbuna | XP_004558442 |
106582 |
| Neolamprologus brichardi | Neolamprologus brichardi | XP_006791597 |
32507 |
| Oreochromis mossambicus | Mozambique tilapia | AAZ52553 |
8127 |
| Oreochromis niloticus | Nile tilapia | XP_003452874 |
8128 |
| Oryzias latipes | Japanese medaka | XP_004071520 |
8090 |
| Poecilia formosa | Amazon molly | XP_007557481 XP_007557471 |
48698 |
| Poecilia mexicana | Poecilia mexicana | XP_014836150 |
48701 |
| Pundamilia nyererei | Pundamilia nyererei | XP_005734654 |
303518 |
| Siniperca chuatsi | Mandarin fish | ADA70321 |
119488 |
| Stegastes partitus | Bicolor damselfish | XP_008286260 |
144197 |
| Xiphophorus maculatus | Southern platyfish | XP_005808788 |
8083 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.