If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AGDVDGDGK
Peptide within the protein Lep-w-1:
MTFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRSK
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AGDVDGDGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Cyprinodon variegatus | Cyprinodon variegatus | XP_015250296 |
28743 |
| Latimeria chalumnae | Coelacanth | XP_005998419 |
7897 |
| Lepidorhombus whiffiagonis | Megrim | CAP17694 |
154550 |
| Oryzias latipes | Japanese medaka | XP_004071524 |
8090 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.