If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: ETANFLK
Peptide within the protein Lep-w-1:
MTFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRSK
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide ETANFLK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Echinops telfairi | Small madagascar hedgehog | XP_004706275 |
9371 |
| Capsicum annuum | Capsicum annuum | XP_016569330 |
4072 |
| Chrysochloris asiatica | Cape golden mole | XP_006874079 |
185453 |
| Daphnia magna | Daphnia magna | JAN80964 |
35525 |
| Dasypus novemcinctus | Nine-banded armadillo | XP_004475912 XP_004475911 XP_004475910 |
9361 |
| Elephantulus edwardii | Cape elephant shrew | XP_006897545 |
28737 |
| Entamoeba invadens IP1 | Entamoeba invadens ip1 | XP_004254968 |
370355 |
| Jaapia argillacea MUCL 33604 | Jaapia argillacea mucl 33604 | KDQ64455 |
933084 |
| Lepidorhombus whiffiagonis | Megrim | CAP17694 |
154550 |
| Loxodonta africana | African savanna elephant | XP_010595792 |
9785 |
| Malassezia sympodialis ATCC 42132 | Malassezia sympodialis atcc 42132 | CCU99399 |
1230383 |
| Nicotiana sylvestris | Wood tobacco | XP_009803841 |
4096 |
| Nicotiana tabacum | Common tobacco | XP_016468399 XP_016461298 |
4097 |
| Nicotiana tomentosiformis | Nicotiana tomentosiformis | XP_009617931 |
4098 |
| Oncorhynchus mykiss | Rainbow trout | CDQ61327 |
8022 |
| Orycteropus afer afer | Orycteropus afer afer | XP_007937896 |
1230840 |
| Oxytricha trifallax | Oxytricha trifallax | EJY75027 |
1172189 |
| Salmo salar | Atlantic salmon | XP_014069538 |
8030 |
| Sistotremastrum niveocremeum HHB9708 | Sistotremastrum niveocremeum hhb9708 | KZS91097 |
1314777 |
| Solanum lycopersicum | Tomato | XP_004237884 |
4081 |
| Solanum pennellii | Solanum pennellii | XP_015071418 |
28526 |
| Sporisorium scitamineum | Sporisorium scitamineum | CDW94017 CDR87373 |
49012 |
| Stegastes partitus | Bicolor damselfish | XP_008295774 |
144197 |
| Tribolium castaneum | Red flour beetle | XP_008198356 XP_970545 |
7070 |
| Trichechus manatus latirostris | Florida manatee | XP_012410072 |
127582 |
| Zymoseptoria brevis | Zymoseptoria brevis | KJX93174 |
1047168 |
| Zymoseptoria tritici IPO323 | Zymoseptoria tritici ipo323 | XP_003849646 |
336722 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.