If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: DDQNPHSSNICNISCDK
Peptide within the protein Bos-d-4:
MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide DDQNPHSSNICNISCDK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Bison bison bison | Bison | NP_776803 |
43346 |
| Bos grunniens | Domestic yak | NP_776803 AER42591 |
30521 |
| Bos indicus | Zebu (humped cattle) | AAF06794 ABW77760 |
9915 |
| Bos mutus | Wild yak | NP_776803 |
72004 |
| Bos taurus | Cattle | 1F6R_A CAA44927 1HFZ_A NP_776803 AAF63624 |
9913 |
| Bubalus bubalis | Water buffalo | AAF06794 Q9TSN6 NP_001277865 |
89462 |
| Cervus elaphus xanthopygus | Manchurian wapiti | AAF06795 |
9865 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.