If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: FLDDDLTDDIMCVK
Peptide within the protein Bos-d-4:
MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide FLDDDLTDDIMCVK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Cervus elaphus xanthopygus | Manchurian wapiti | AAF06795 |
9865 |
| Dasypus novemcinctus | Nine-banded armadillo | XP_004468429 |
9361 |
| Delphinus delphis | Saddleback dolphin | AAG27444 |
9728 |
| Eschrichtius robustus | Grey whale | AAG27454 AAR37354 |
9764 |
| Eubalaena australis | Southern right whale | AAR37353 |
160595 |
| Eubalaena glacialis | North atlantic right whale | AAR37340 |
27606 |
| Fukomys damarensis | Fukomys damarensis | KFO33445 XP_010621995 |
885580 |
| Globicephala sp. IIC2000 | Globicephala sp. iic2000 | AAG27445 |
139690 |
| Orcinus orca | Killer whale | XP_004274443 |
9733 |
| Orycteropus afer afer | Orycteropus afer afer | XP_007936067 |
1230840 |
| Ovis aries | Sheep | P09462 |
9940 |
| Physeter catodon | Sperm whale | XP_007107591 |
9755 |
| Platanista gangetica | Ganges river dolphin | AAG27449 |
118798 |
| Balaenoptera acutorostrata | Minke whale | AAR37339 AAR37342 |
9767 |
| Balaenoptera acutorostrata scammoni | Balaenoptera acutorostrata scammoni | XP_007179325 |
310752 |
| Balaenoptera bonaerensis | Antarctic minke whale | AAR37338 |
33556 |
| Balaenoptera musculus | Blue whale | AAR37348 |
9771 |
| Balaenoptera physalus | Fin whale | AAR37341 AAR37345 AAR37346 AAR37349 AAR37343 |
9770 |
| Bison bison bison | Bison | NP_776803 |
43346 |
| Bos grunniens | Domestic yak | NP_776803 Q9TSR4 AER42591 |
30521 |
| Bos indicus | Zebu (humped cattle) | LABOZ AAF06794 ABW77760 |
9915 |
| Bos mutus | Wild yak | NP_776803 |
72004 |
| Bos taurus | Cattle | 1F6R_A CAA44927 NP_776803 AAF63624 AEV46829 |
9913 |
| Bubalus bubalis | Water buffalo | AGG10763 AAF06794 Q9TSN6 NP_001277865 |
89462 |
| Caperea marginata | Pygmy right whale | AAR37350 |
27604 |
| Cephalorhynchus eutropia | Black dolphin | AAG27443 |
27608 |
| Sotalia fluviatilis | Gray dolphin | AAG27446 |
103598 |
| Tursiops truncatus | Bottlenosed dolphin | XP_004324918 |
9739 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.