Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL
None.
Species containing the peptide LDQWLCEK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Bison bison bison | Bison | NP_776803 |
43346 |
| Bos grunniens | Domestic yak | NP_776803 Q9TSR4 AER42591 |
30521 |
| Bos indicus | Zebu (humped cattle) | LABOZ AAF06794 |
9915 |
| Bos mutus | Wild yak | NP_776803 |
72004 |
| Bos taurus | Cattle | 1F6R_A CAA44927 1HFZ_A NP_776803 AAF63624 AEV46829 |
9913 |
| Bubalus bubalis | Water buffalo | AGG10763 AAF06794 Q9TSN6 NP_001277865 |
89462 |
| Capra hircus | Goat | ACC44852 1HFY_A 3B0K_A 1FKV_A 1HMK_A 1FKQ_A NP_001272564 |
9925 |
| Cervus elaphus xanthopygus | Manchurian wapiti | AAF06795 |
9865 |
| Manis javanica | Malayan pangolin | XP_017502031 |
9974 |
| Ovis aries | Sheep | P09462 NP_001009797 |
9940 |
| Pantholops hodgsonii | Chiru | XP_005981064 |
59538 |
| Sus scrofa | Pig | NP_999525 |
9823 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.