Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL
None.
Species containing the peptide MMSFVSLLLVGILFHATQAEQLTK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Bison bison bison | Bison | NP_776803 |
43346 |
| Bos grunniens | Domestic yak | NP_776803 Q9TSR4 |
30521 |
| Bos indicus | Zebu (humped cattle) | AAF06794 ABW77760 |
9915 |
| Bos mutus | Wild yak | NP_776803 |
72004 |
| Bos taurus | Cattle | BAA92833 BAA86919 BAA86914 NP_776803 AAF63624 AEV46829 |
9913 |
| Bubalus bubalis | Water buffalo | ABN54437 AAU13911 AAU13910 AAU13909 AAF06794 Q9TSN6 |
89462 |
| Capra hircus | Goat | ACC44851 NP_001272564 |
9925 |
| Ovis aries | Sheep | BAA92832 P09462 NP_001009797 |
9940 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.