If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VGINYWLAHK
Peptide within the protein Bos-d-4:
MMSFVSLLLVGILFHATQAEQLTKCEVFRELKDLKGYGGVSLPEWVCTTFHTSGYDTQAIVQNNDSTEYGLFQINNKIWCKDDQNPHSSNICNISCDKFLDDDLTDDIMCVKKILDKVGINYWLAHKALCSEKLDQWLCEKL
References reporting this peptide:
- Ansari P., et al. Selection of possible marker peptides for the detection of major ruminant milk proteins in food by liquid chromatography-tandem mass spectrometry. Analytical and Bioanalytical Chemistry. 2011
- Zhang, et al. Multiple reaction monitoring-based determination of bovine ?-lactalbumin in infant formulas and whey protein concentrates by ultra-high performance liquid chromatography-tandem mass spectrometry using tryptic signature peptides and synthetic peptide stand. Analytica chimica acta. 2012
Species Uniqueness
Species containing the peptide VGINYWLAHK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Balaenoptera acutorostrata scammoni | Balaenoptera acutorostrata scammoni | XP_007179325 |
310752 |
| Bison bison bison | Bison | NP_776803 |
43346 |
| Bos grunniens | Domestic yak | NP_776803 Q9TSR4 AER42591 |
30521 |
| Bos indicus | Zebu (humped cattle) | LABOZ AAF06794 ABW77760 |
9915 |
| Bos mutus | Wild yak | NP_776803 |
72004 |
| Bos taurus | Cattle | 1F6R_A CAA44927 1HFZ_A NP_776803 AAF63624 AEV46829 |
9913 |
| Bubalus bubalis | Water buffalo | AGG10763 AAF06794 Q9TSN6 NP_001277865 |
89462 |
| Capra hircus | Goat | 1HFY_A 3B0K_A 1FKV_A 1HMK_A 1FKQ_A NP_001272564 |
9925 |
| Cervus elaphus xanthopygus | Manchurian wapiti | AAF06795 |
9865 |
| Lipotes vexillifer | Yangtze river dolphin | XP_007452290 |
118797 |
| Orcinus orca | Killer whale | XP_004274443 |
9733 |
| Ovis aries | Sheep | P09462 NP_001009797 |
9940 |
| Pantholops hodgsonii | Chiru | XP_005981064 |
59538 |
| Physeter catodon | Sperm whale | XP_007107591 |
9755 |
| Tursiops truncatus | Bottlenosed dolphin | XP_004324918 |
9739 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.