Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Milk Protein: Bos d 5 | β-Lactoglobulin
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 178 amino acids
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
UniProt: P02754 IUIS: Bos d 5Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| K | CLLLALALTCGAQALIVTQTMK | G | 0 | 0.353 | 0.13162 |
| K | VAGTWYSLAMAASDISLLDAQSAPLR | V | 1 | 0.414 | 0.03706 |
| R | VYVEELKPTPEGDLEILLQK | W | 4 | 0.698 | 0.17484 |
| K | WENGECAQK | K | 0 | 0.217 | 0.23618 |
| K | IDALNENK | V | 1 | 0.267 | 0.44124 |
| K | VLVLDTDYK | K | 6 | 0.451 | 0.43126 |
| K | YLLFCMENSAEPEQSLACQCLVR | T | 0 | 0.389 | 0.06702 |
| R | TPEVDDEALEK | F | 5 | 0.448 | 0.41366 |
| K | ALPMHIR | L | 0 | 0.235 | 0.25912 |
| R | LSFNPTQLEEQCHI | $ | 4 | 0.608 | 0.39826 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.