If you found this site useful, please cite: Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Milk Protein: Bos d 5 | β-Lactoglobulin

Empirical Proteotypic Peptide Explorer:

This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.

Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.


Sequence - 178 amino acids

MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

UniProt: P02754   IUIS: Bos d 5

Peptide Selector Tool

Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.

Exclude:
Peptide Characteristics:

Minimum length:

Maximum length:

1Peptide2Exp.3ESP4CONSeQ5
R LSFNPTQLEEQCHI $ 4 0.608 0.39826
R TPEVDDEALEK F 5 0.448 0.41366
K CLLLALALTCGAQALIVTQTMK G 0 0.353 0.13162
K WENGECAQK K 0 0.217 0.23618
K VLVLDTDYK K 6 0.451 0.43126
K ALPMHIR L 0 0.235 0.25912
K YLLFCMENSAEPEQSLACQCLVR T 0 0.389 0.06702
K VAGTWYSLAMAASDISLLDAQSAPLR V 1 0.414 0.03706
K IDALNENK V 1 0.267 0.44124
R VYVEELKPTPEGDLEILLQK W 4 0.698 0.17484

1 Previous amino acid (^ = Start of protein)

2 Next amino acid ($ = End of protein)

3 Exp. = Number of publications in which this peptide has been reported experimentally

4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi

5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi

Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.

Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.