If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: EFQQAQHLR
Peptide within the protein Bra-j-1:
AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQPQGPQQRPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICPFQKTMPGPS
References reporting this peptide:
- Posada-Ayala, et al. Novel liquid chromatography-mass spectrometry method for sensitive determination of the mustard allergen Sin a 1 in food. Food Chemistry. 2015
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Mustard | Bra-j-1.0101 | 3707 |
| Mustard | Sin-a-1.0101 | 3728 |
Species containing the peptide EFQQAQHLR are presented below. Accessions and taxid values link to further information hosted on NCBI.
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.