If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: IYQTATHLPR
Peptide within the protein Bra-j-1:
AGPFRFPRCRKEFQQAQHLRACQQWLHKQAMQSGSGPQPQGPQQRPPLLQQCCNELHQEEPLCVCPTLKGASKAVKQQIRQQGQQQGQQGQQLQHEISRIYQTATHLPRVCNIPRVSICPFQKTMPGPS
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide IYQTATHLPR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Brassica rapa subsp. chinensis | Brassica rapa subsp. chinensis | ADH95019 |
93385 |
| Brassica rapa subsp. oleifera | Brassica rapa subsp. oleifera | AAA32998 |
145471 |
| Brassica juncea | Brassica juncea | AAB27813 P80207 |
3707 |
| Brassica napus | Rape | AAB37417 AAB37418 CDY29281 CDX70800 XP_013589349 XP_013681845 XP_013729988 |
3708 |
| Brassica nigra | Black mustard | CAA46784 |
3710 |
| Brassica oleracea var. oleracea | Brassica oleracea var. oleracea | XP_013589349 XP_013623354 |
109376 |
| Brassica rapa | Field mustard | XP_009131634 |
3711 |
| Raphanus sativus | Radish | AAA63471 AAA63470 AAA63472 |
3726 |
| Sinapis alba | White mustard | CAA62909 |
3728 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.