If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GAGGVTIK
Peptide within the protein Sin-a-4:
MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVERLGDYLIEQGL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GAGGVTIK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Arabidopsis lyrata subsp. lyrata | Arabidopsis lyrata subsp. lyrata | XP_002866157 |
81972 |
| Arabidopsis thaliana | Thale cress | OAO93241 NP_200471 AAK59494 AAN41285 |
3702 |
| Arabis alpina | Gray rockcress | KFK27226 |
50452 |
| Brassica napus | Rape | CDY03443 XP_013687452 XP_013666995 CDY32870 XP_013740304 XP_013626154 CDX88579 CDY11912 XP_013729132 CDY13363 |
3708 |
| Brassica oleracea var. oleracea | Brassica oleracea var. oleracea | XP_013626154 XP_013589297 XP_013612142 |
109376 |
| Brassica rapa | Field mustard | XP_009120170 XP_009132193 |
3711 |
| Camelina sativa | Camelina sativa | XP_010451283 |
90675 |
| Capsella rubella | Capsella rubella | XP_006281613 |
81985 |
| Claviceps purpurea 20.1 | Claviceps purpurea 20.1 | CCE28312 |
1111077 |
| Eutrema halophilum | Eutrema halophilum | BAJ34266 |
98038 |
| Hebeloma cylindrosporum h7 | Hebeloma cylindrosporum h7 | KIM36767 |
686832 |
| Humulus scandens | Humulus scandens | AAP15200 |
228586 |
| Methanolacinia paynteri | Methanolacinia paynteri | WP_048149463 |
230356 |
| Methanoplanus petrolearius | Methanoplanus petrolearius | WP_013330617 |
54120 |
| Methanoplanus petrolearius DSM 11571 | Methanoplanus petrolearius dsm 11571 | WP_013330617 |
679926 |
| Musa acuminata subsp. malaccensis | Wild malaysian banana | XP_009399807 |
214687 |
| Neonectria ditissima | Neonectria ditissima | KPM39986 |
78410 |
| Sinapis alba | White mustard | ABU95412 |
3728 |
| Tolypocladium ophioglossoides CBS 100239 | Tolypocladium ophioglossoides cbs 100239 | KND90401 |
1163406 |
| Trametes cinnabarina | Trametes cinnabarina | CDO75521 |
5643 |
| Trichoderma reesei QM6a | Trichoderma reesei qm6a | XP_006963339 |
431241 |
| Trichoderma reesei RUT C-30 | Trichoderma reesei rut c-30 | XP_006963339 |
1344414 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.