If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: YMVIQGEPNAVIR
Peptide within the protein Sin-a-4:
MSWQTYVDDHLMCDVEGNRLTAAAILGQDGSVWAQSANFPQLKPEEIKGINNDFAEPGTLAPTGLFIGGTKYMVIQGEPNAVIRGKKGAGGVTIKKTTQAFVFGIYEEPMTPGQCNMVVERLGDYLIEQGL
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Mustard | Sin-a-4.0101 | 3728 |
| Celery | Api-g-4.0101 | 4045 |
Species containing the peptide YMVIQGEPNAVIR are presented below. Accessions and taxid values link to further information hosted on NCBI.
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.