If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AGGISLAR
Peptide within the protein Pon-l-4:
AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNLWNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLVGVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESANAVYLFGPLKEVQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AGGISLAR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Eriocheir sinensis | Chinese mitten crab | AJG01361 AJG01360 AJG01359 |
95602 |
| Pontastacus leptodactylus | Narrow-clawed crayfish | P05946 |
6717 |
| Procambarus clarkii | Red swamp crayfish | AFV09840 ABB58783 AEG79569 AEG79568 AEG79567 |
6728 |
| Rhizoctonia solani | Rhizoctonia solani | CUA71442 |
456999 |
| Rhizoctonia solani 123E | Rhizoctonia solani 123e | EUC65114 |
1423351 |
| Rhizoctonia solani AG-1 IA | Rhizoctonia solani ag-1 ia | ELU37328 |
983506 |
| Rhizoctonia solani AG-1 IB | Rhizoctonia solani ag-1 ib | CEL55097 |
1108050 |
| Rhizoctonia solani AG-3 Rhs1AP | Rhizoctonia solani ag-3 rhs1ap | EUC65114 |
1086054 |
| Rhizoctonia solani AG-8 WAC10335 | Rhizoctonia solani ag-8 wac10335 | KDN35141 |
1287689 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.