If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SAFANIK
Peptide within the protein Pon-l-4:
AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNLWNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLVGVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESANAVYLFGPLKEVQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SAFANIK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Exophiala xenobiotica | Exophiala xenobiotica | XP_013313831 |
348802 |
| Acidomyces richmondensis | Acidomyces richmondensis | KXL44894 |
245562 |
| Acidomyces richmondensis BFW | Acidomyces richmondensis bfw | KXL44894 |
766039 |
| Apis florea | Little honeybee | XP_012339271 |
7463 |
| Arabidopsis thaliana | Thale cress | OAO89071 |
3702 |
| Arthroderma benhamiae CBS 112371 | Arthroderma benhamiae cbs 112371 | DAA78670 XP_003016493 |
663331 |
| Arthroderma otae CBS 113480 | Arthroderma otae cbs 113480 | XP_002846535 |
554155 |
| Aureobasidium pullulans EXF-150 | Aureobasidium pullulans exf-150 | KEQ80893 |
1043002 |
| Cladophialophora bantiana CBS 173.52 | Cladophialophora bantiana cbs 173.52 | XP_016617056 |
1442370 |
| Cladophialophora psammophila CBS 110553 | Cladophialophora psammophila cbs 110553 | XP_007745415 |
1182543 |
| Cryptococcus amylolentus CBS 6039 | Cryptococcus amylolentus cbs 6039 | ODN79807 |
1295533 |
| Cryptococcus amylolentus CBS 6273 | Cryptococcus amylolentus cbs 6273 | ODN79807 |
1296118 |
| Cryptococcus gattii 2001/935-1 | Cryptococcus gattii 2001/935-1 | KIS01122 |
1334442 |
| Cryptococcus gattii 99/473 | Cryptococcus gattii 99/473 | KIR40716 |
1296104 |
| Cryptococcus gattii CA1014 | Cryptococcus gattii ca1014 | KGB74549 |
1296107 |
| Cryptococcus gattii CA1280 | Cryptococcus gattii ca1280 | KIR50232 |
1296109 |
| Cryptococcus gattii CA1873 | Cryptococcus gattii ca1873 | KIR67211 |
1296111 |
| Cryptococcus gattii CBS 10090 | Cryptococcus gattii cbs 10090 | KIR25377 |
1296101 |
| Cryptococcus gattii E566 | Cryptococcus gattii e566 | KIY36319 |
1296102 |
| Cryptococcus gattii EJB2 | Cryptococcus gattii ejb2 | XP_003192491 |
1296103 |
| Cryptococcus gattii IND107 | Cryptococcus gattii ind107 | KIR87657 |
1296105 |
| Cryptococcus gattii LA55 | Cryptococcus gattii la55 | KIR25377 |
1296106 |
| Cryptococcus gattii MMRL2647 | Cryptococcus gattii mmrl2647 | KIR33732 |
1296117 |
| Cryptococcus gattii NT-10 | Cryptococcus gattii nt-10 | KIY36319 |
1296108 |
| Cryptococcus gattii R265 | Cryptococcus gattii r265 | KGB74549 |
294750 |
| Cryptococcus gattii Ram5 | Cryptococcus gattii ram5 | KIR40716 |
1296110 |
| Cryptococcus gattii Ru294 | Cryptococcus gattii ru294 | KIR55803 |
1296112 |
| Cryptococcus gattii WM276 | Cryptococcus gattii wm276 | XP_003192491 |
367775 |
| Cryptococcus neoformans var. neoformans B-3501A | Cryptococcus neoformans var. neoformans b-3501a | XP_778154 |
283643 |
| Cryptococcus neoformans var. neoformans JEC21 | Cryptococcus neoformans var. neoformans jec21 | XP_567251 |
214684 |
| Diaporthe ampelina | Diaporthe ampelina | KKY36338 |
1214573 |
| Diaporthe helianthi | Diaporthe helianthi | OCW34409 |
158607 |
| Escovopsis weberi | Escovopsis weberi | KOS22479 |
150374 |
| Fonsecaea monophora | Fonsecaea monophora | OAG39223 |
254056 |
| Fonsecaea multimorphosa | Fonsecaea multimorphosa | OAL23068 |
979981 |
| Fonsecaea multimorphosa CBS 102226 | Fonsecaea multimorphosa cbs 102226 | XP_016631117 |
1442371 |
| Fonsecaea nubica | Fonsecaea nubica | OAL23851 |
856822 |
| Fonsecaea pedrosoi CBS 271.37 | Fonsecaea pedrosoi cbs 271.37 | XP_013281688 |
1442368 |
| Gymnopus luxurians FD-317 M1 | Gymnopus luxurians fd-317 m1 | KIK64919 KIK54653 |
944289 |
| Jaapia argillacea MUCL 33604 | Jaapia argillacea mucl 33604 | KDQ56456 |
933084 |
| Lepidopterella palustris CBS 459.81 | Lepidopterella palustris cbs 459.81 | OCK78795 |
1314670 |
| Ophiostoma piceae UAMH 11346 | Ophiostoma piceae uamh 11346 | EPE02782 |
1262450 |
| Pestalotiopsis fici W106-1 | Pestalotiopsis fici w106-1 | XP_007840206 |
1229662 |
| Phialocephala scopiformis | Phialocephala scopiformis | XP_018072912 |
149040 |
| Phialophora attae | Phialophora attae | XP_017999867 |
1664694 |
| Pontastacus leptodactylus | Narrow-clawed crayfish | P05946 |
6717 |
| Procambarus clarkii | Red swamp crayfish | AFV09840 ABB58783 AEG79569 AEG79568 AEG79567 |
6728 |
| Thermococcus sp. ES1 | Thermococcus sp. es1 | AHF80672 |
582419 |
| Trichophyton equinum CBS 127.97 | Trichophyton equinum cbs 127.97 | EGE09128 |
559882 |
| Trichophyton interdigitale H6 | Trichophyton interdigitale h6 | EZF34495 |
1215336 |
| Trichophyton interdigitale MR816 | Trichophyton interdigitale mr816 | KDB23888 |
1215338 |
| Trichophyton tonsurans CBS 112818 | Trichophyton tonsurans cbs 112818 | EGD93743 |
647933 |
| Trichophyton verrucosum HKI 0517 | Trichophyton verrucosum hki 0517 | XP_003019587 |
663202 |
| Tsuchiyaea wingfieldii CBS 7118 | Tsuchiyaea wingfieldii cbs 7118 | ODO08830 |
1295528 |
| Valsa mali | Valsa mali | KUI65920 |
105487 |
| Valsa mali var. pyri | Valsa mali var. pyri | KUI60951 |
694573 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.