If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: YMYDIDNNGFLDK
Peptide within the protein Pon-l-4:
AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNLWNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLVGVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESANAVYLFGPLKEVQ
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Cra-c-4.0101 | 491138 |
| Shrimp | Lit-v-4.0101 | 6689 |
| Shrimp | Pen-m-4.0101 | 6687 |
| Crayfish | Pon-l-4.0101 | 6717 |
Species containing the peptide YMYDIDNNGFLDK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Caligus rogercresseyi | Caligus rogercresseyi | ACO11179 ACO10496 ACO11179 ACO10496 ACO11179 ACO10496 ACO11179 ACO10496 |
217165 |
| Crangon crangon | Crangon crangon | ACR43475 ACR43475 ACR43475 ACR43475 |
491138 |
| Lepeophtheirus salmonis | Salmon louse | ACO12721 ACO11757 ACO12721 ACO11757 ACO12721 ACO11757 ACO12721 ACO11757 |
72036 |
| Litopenaeus vannamei | Pacific white shrimp | ACM89179 ACM89179 ACM89179 ACM89179 |
6689 |
| Marsupenaeus japonicus | Marsupenaeus japonicus | BAL72726 BAL72726 BAL72726 BAL72726 |
27405 |
| Penaeus monodon | Black tiger shrimp | BAL72725 ACM89179 BAL72725 ACM89179 BAL72725 ACM89179 BAL72725 ACM89179 |
6687 |
| Pontastacus leptodactylus | Narrow-clawed crayfish | P05946 P05946 P05946 P05946 |
6717 |
| Procambarus clarkii | Red swamp crayfish | ABB58783 AEG79569 AEG79568 AEG79567 ABB58783 AEG79569 AEG79568 AEG79567 ABB58783 AEG79569 AEG79568 AEG79567 ABB58783 AEG79569 AEG79568 AEG79567 |
6728 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.