If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: YQELYAQFISNPDESANAVYLFGPLK
Peptide within the protein Pon-l-4:
AYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLALRNTLIEGRGEFNEAAYANNQKIMSNLWNEIAELADFNKDGEVTIDEFKKAVQNVCVGKAFATFPAAFKVFIANQFKTVDVNGDGLVGVDEYRLDCISRSAFANIKEIDDAYNKLATDADKKAGGISLARYQELYAQFISNPDESANAVYLFGPLKEVQ
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide YQELYAQFISNPDESANAVYLFGPLK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Pontastacus leptodactylus | Narrow-clawed crayfish | P05946 |
6717 |
| Procambarus clarkii | Red swamp crayfish | AFV09840 ABB58783 AEG79569 AEG79568 AEG79567 |
6728 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.