Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: DFGDLEK
Peptide within the protein Cra-c-2:
MVDAEVLEKLEAGYKKLEAATDCKSLLKKYLTKEVFDELKTKKTALGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQSDKHPGKDFGDLEKFVNVDPEGTFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMESKVSSTLSSLEGELKGTYYPLTGMSKDVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANRDKLESVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILEPIKMEKEM
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide DFGDLEK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Anolis carolinensis | Green anole | XP_008106371 |
28377 |
| Arabidopsis thaliana | Thale cress | OAP04576 OAP04575 |
3702 |
| Caenorhabditis brenneri | Caenorhabditis brenneri | EGT50396 EGT58632 EGT58692 |
135651 |
| Crangon crangon | Crangon crangon | ACR43474 |
491138 |
| Crassostrea gigas | Pacific oyster | XP_011421419 |
29159 |
| Methanosaeta concilii | Methanosaeta concilii | WP_013718635 |
2223 |
| Methanosaeta concilii GP6 | Methanosaeta concilii gp6 | WP_013718635 |
990316 |
| Sarcophilus harrisii | Tasmanian devil | XP_003764662 |
9305 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.