If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: LESVAGK
Peptide within the protein Cra-c-2:
MVDAEVLEKLEAGYKKLEAATDCKSLLKKYLTKEVFDELKTKKTALGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQSDKHPGKDFGDLEKFVNVDPEGTFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMESKVSSTLSSLEGELKGTYYPLTGMSKDVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANRDKLESVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILEPIKMEKEM
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide LESVAGK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Lactobacillus phage LF1 | Lactobacillus phage lf1 | YP_007003253 |
947980 |
| Leishmania donovani | Leishmania donovani | XP_003860174 |
5661 |
| Leishmania infantum JPCM5 | Leishmania infantum jpcm5 | XP_001464972 |
435258 |
| Leishmania major strain Friedlin | Leishmania major strain friedlin | XP_001682570 |
347515 |
| Lepidopterella palustris CBS 459.81 | Lepidopterella palustris cbs 459.81 | OCK80345 |
1314670 |
| Leptonychotes weddellii | Weddell seal | XP_006737830 |
9713 |
| Lingula anatina | Lingula anatina | XP_013406126 |
7574 |
| Kuraishia capsulata CBS 1993 | Kuraishia capsulata cbs 1993 | CDK27471 |
1382522 |
| Ailuropoda melanoleuca | Giant panda | XP_002920693 EFB27321 |
9646 |
| Alternaria alternata | Alternaria alternata | BAK07351 |
5599 |
| Aplysia californica | California sea hare | XP_005107698 XP_012943117 |
6500 |
| Aspergillus kawachii IFO 4308 | Aspergillus kawachii ifo 4308 | GAA83145 |
1033177 |
| Aspergillus luchuensis | Aspergillus luchuensis | GAA83145 |
1069201 |
| Aspergillus niger | Aspergillus niger | XP_001393027 GAQ47361 |
5061 |
| Aspergillus niger ATCC 1015 | Aspergillus niger atcc 1015 | EHA18386 |
380704 |
| Aspergillus niger CBS 513.88 | Aspergillus niger cbs 513.88 | XP_001393027 |
425011 |
| Aureobasidium pullulans EXF-150 | Aureobasidium pullulans exf-150 | KEQ81344 |
1043002 |
| Bos taurus | Cattle | XP_002707864 |
9913 |
| Bubalus bubalis | Water buffalo | XP_006046124 XP_006046123 |
89462 |
| Camelus bactrianus | Bactrian camel | XP_010957151 |
9837 |
| Camelus dromedarius | Arabian camel | XP_010986505 |
9838 |
| Camelus ferus | Wild bactrian camel | XP_006191155 |
419612 |
| Canis lupus familiaris | Dog | XP_003432026 |
9615 |
| Capra hircus | Goat | XP_017903067 XP_017903066 |
9925 |
| Chlamydomonas reinhardtii | Chlamydomonas reinhardtii | XP_001691170 |
3055 |
| Chrysochloris asiatica | Cape golden mole | XP_006871687 |
185453 |
| Cordyceps confragosa RCEF 1005 | Cordyceps confragosa rcef 1005 | OAA75926 |
1081108 |
| Crangon crangon | Crangon crangon | ACR43474 |
491138 |
| Cyprinus carpio | Common carp | KTG43777 |
7962 |
| Dasypus novemcinctus | Nine-banded armadillo | XP_004473019 |
9361 |
| Dinoponera quadriceps | Dinoponera quadriceps | XP_014469967 |
609295 |
| Drosophila rhopaloa | Drosophila rhopaloa | XP_016988348 XP_016988357 |
1041015 |
| Echinops telfairi | Small madagascar hedgehog | XP_004700493 |
9371 |
| Esox lucius | Northern pike | XP_010872976 XP_010872975 |
8010 |
| Halolamina sp. CBA1107 | Halolamina sp. cba1107 | WP_049980206 |
1380430 |
| Halolamina sp. halo-7 | Halolamina sp. halo-7 | WP_053948294 |
1480675 |
| Hordeum vulgare subsp. vulgare | Domesticated barley | BAK07351 |
112509 |
| Klebsormidium flaccidum | Klebsormidium flaccidum | GAQ92135 |
3175 |
| Lipotes vexillifer | Yangtze river dolphin | XP_007448814 |
118797 |
| Loxodonta africana | African savanna elephant | XP_003405647 |
9785 |
| Madurella mycetomatis | Madurella mycetomatis | KXX80148 |
100816 |
| Microcebus murinus | Gray mouse lemur | XP_012605822 XP_012605821 |
30608 |
| Mustela putorius furo | Domestic ferret | XP_004752437 XP_004752435 |
9669 |
| Nosema apis BRL 01 | Nosema apis brl 01 | EQB59970 EQB59971 |
1037528 |
| Odobenus rosmarus divergens | Pacific walrus | XP_004404886 |
9708 |
| Oikopleura dioica | Oikopleura dioica | CBY21009 |
34765 |
| Orcinus orca | Killer whale | XP_004271619 |
9733 |
| Orycteropus afer afer | Orycteropus afer afer | XP_007945748 |
1230840 |
| Oryza sativa Japonica Group | Japanese rice | ABA97258 |
39947 |
| Ovis aries | Sheep | XP_014950035 XP_004006253 |
9940 |
| Ovis aries musimon | Mouflon | XP_014964692 XP_012005608 |
9938 |
| Pantholops hodgsonii | Chiru | XP_005976380 |
59538 |
| Physeter catodon | Sperm whale | XP_007125877 |
9755 |
| Phytophthora parasitica | Phytophthora parasitica | ETL50720 ETK76638 ETL95086 |
4792 |
| Phytophthora sojae | Phytophthora sojae | XP_009523516 |
67593 |
| Plasmodium vivax | Malaria parasite p. vivax | XP_001612693 |
5855 |
| Plasmodium vivax Brazil I | Plasmodium vivax brazil i | XP_001612693 |
1033975 |
| Plasmodium vivax India VII | Plasmodium vivax india vii | XP_001612693 |
1077284 |
| Plasmodium vivax Mauritania I | Plasmodium vivax mauritania i | KMZ94295 |
1035515 |
| Plasmodium vivax North Korean | Plasmodium vivax north korean | XP_001612693 |
1035514 |
| Plasmodium vivax Sal-1 | Plasmodium vivax sal-1 | XP_001612693 |
126793 |
| Propithecus coquereli | Coquerel's sifaka | XP_012503819 |
379532 |
| Pundamilia nyererei | Pundamilia nyererei | XP_005721776 |
303518 |
| Pyrenochaeta sp. DS3sAY3a | Pyrenochaeta sp. ds3say3a | OAL52921 |
765867 |
| Sorex araneus | European shrew | XP_004602873 |
42254 |
| Stachybotrys chartarum IBT 7711 | Stachybotrys chartarum ibt 7711 | KEY69253 |
1280523 |
| Sulfolobus acidocaldarius | Sulfolobus acidocaldarius | WP_011278516 WP_024084188 |
2285 |
| Sulfolobus acidocaldarius DSM 639 | Sulfolobus acidocaldarius dsm 639 | WP_011278516 |
330779 |
| Sulfolobus acidocaldarius N8 | Sulfolobus acidocaldarius n8 | AGE71619 |
1028566 |
| Sulfolobus acidocaldarius Ron12/I | Sulfolobus acidocaldarius ron12/i | WP_011278516 |
1028567 |
| Sulfolobus acidocaldarius SUSAZ | Sulfolobus acidocaldarius susaz | WP_024084188 |
1435377 |
| Sus scrofa | Pig | XP_003481713 |
9823 |
| Trichechus manatus latirostris | Florida manatee | XP_004384680 |
127582 |
| Trypanosoma grayi | Trypanosoma grayi | XP_009310041 |
71804 |
| Tupaia chinensis | Chinese tree shrew | XP_006142914 XP_006142912 ELW70515 |
246437 |
| Tursiops truncatus | Bottlenosed dolphin | XP_004319908 |
9739 |
| Ursus maritimus | Polar bear | XP_008682547 |
29073 |
| Vicugna pacos | Alpaca | XP_006197907 |
30538 |
| Vitis vinifera | Wine grape | CAN64572 CBI35583 XP_002264454 |
29760 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.