Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: MGLTEFQAVK
Peptide within the protein Cra-c-2:
MVDAEVLEKLEAGYKKLEAATDCKSLLKKYLTKEVFDELKTKKTALGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFAPLFDPIIEDYHVGFKQSDKHPGKDFGDLEKFVNVDPEGTFVVSTRVRCGRSMEGYPFNPCLTEAQYKEMESKVSSTLSSLEGELKGTYYPLTGMSKDVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANRDKLESVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILEPIKMEKEM
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shrimp | Cra-c-2.0101 | 491138 |
| Shrimp | Lit-v-2.0101 | 6689 |
| Shrimp | Pen-m-2.0101 | 6687 |
Species containing the peptide MGLTEFQAVK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Homarus gammarus | European lobster | P14208 P14208 P14208 |
6707 |
| Halyomorpha halys | Brown marmorated stink bug | XP_014280927 XP_014280926 XP_014280927 XP_014280926 XP_014280927 XP_014280926 |
286706 |
| Aleuroglyphus ovatus | Brown legged grain mite | ABU97463 ABU97463 ABU97463 |
212130 |
| Anasa tristis | Squash bug | AFK29278 AFK29278 AFK29278 |
236421 |
| Anopheles darlingi | Anopheles darlingi | ETN62321 ETN62321 ETN62321 |
43151 |
| Anopheles gambiae str. PEST | Anopheles gambiae str. pest | XP_001688696 XP_315641 XP_001688696 XP_315641 XP_001688696 XP_315641 |
180454 |
| Anopheles sinensis | Anopheles sinensis | KFB47038 KFB47038 KFB47038 |
74873 |
| Carcinus maenas | Green crab | Q9U9J4 Q9U9J4 Q9U9J4 |
6759 |
| Cherax cainii | Cherax cainii | AJO70187 AJO70187 AJO70187 |
223846 |
| Chionoecetes opilio | Snow crab | P86699 P86699 P86699 |
41210 |
| Crangon crangon | Crangon crangon | ACR43474 ACR43474 ACR43474 |
491138 |
| Daphnia magna | Daphnia magna | JAN91448 JAN91448 JAN91448 |
35525 |
| Eriocheir sinensis | Chinese mitten crab | Q9NH48 Q9NH48 Q9NH48 |
95602 |
| Fenneropenaeus chinensis | Fenneropenaeus chinensis | AAS98886 AAS98890 AAV83993 AAS98886 AAS98890 AAV83993 AAS98886 AAS98890 AAV83993 |
139456 |
| Fenneropenaeus merguiensis | Fenneropenaeus merguiensis | ACP43442 ACP43442 ACP43442 |
71412 |
| Glycyphagus domesticus | Glycyphagus domesticus | ABU97463 ABU97463 ABU97463 |
105145 |
| Litopenaeus vannamei | Pacific white shrimp | ADN43035 4BHL_A 4BG4_B 4BG4_A 4AM1_A ABY57915 ABI98020 ADN43035 4BHL_A 4BG4_B 4BG4_A 4AM1_A ABY57915 ABI98020 ADN43035 4BHL_A 4BG4_B 4BG4_A 4AM1_A ABY57915 ABI98020 |
6689 |
| Lucilia cuprina | Australian sheep blowfly | AFD97743 AFD97742 KNC27254 AFD97743 AFD97742 KNC27254 AFD97743 AFD97742 KNC27254 |
7375 |
| Macrophthalmus japonicus | Macrophthalmus japonicus | AID47194 AID47194 AID47194 |
138195 |
| Marsupenaeus japonicus | Marsupenaeus japonicus | P51545 P51545 P51545 |
27405 |
| Metapenaeus ensis | Metapenaeus ensis | ACA51932 ACA51932 ACA51932 |
32278 |
| Metaseiulus occidentalis | Western predatory mite | XP_003743522 XP_003743522 XP_003743522 |
34638 |
| Neohelice granulata | Neohelice granulata | AAF43438 AAF43438 AAF43438 |
53323 |
| Orchesella cincta | Orchesella cincta | ODM97523 ODM97523 ODM97523 |
48709 |
| Pachygrapsus marmoratus | Marbled crab | Q9GYX1 Q9GYX1 Q9GYX1 |
135190 |
| Penaeus monodon | Black tiger shrimp | AAO15713 AGV55412 C7E3T4 AAO15713 AGV55412 C7E3T4 AAO15713 AGV55412 C7E3T4 |
6687 |
| Procambarus clarkii | Red swamp crayfish | ABZ79135 AFA45339 ABZ79135 AFA45339 ABZ79135 AFA45339 |
6728 |
| Riptortus pedestris | Riptortus pedestris | BAN20219 BAN20219 BAN20219 |
329032 |
| Sarcoptes scabiei | Sarcoptes scabiei | KPM07362 KPM07362 KPM07362 |
52283 |
| Scylla olivacea | Orange mud crab | ACP43443 ACP43443 ACP43443 |
85551 |
| Scylla paramamosain | Green mud crab | AFG28553 AFK25805 AFA45340 AEY84969 AFG28553 AFK25805 AFA45340 AEY84969 AFG28553 AFK25805 AFA45340 AEY84969 |
85552 |
| Scylla serrata | Giant mud crab | ACV96855 ACV96855 ACV96855 |
6761 |
| Trichinella spiralis | Trichinella spiralis | KRY07170 KRY07170 KRY07170 |
6334 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.