If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GEWSAEK
Peptide within the protein Cra-c-4:
MAYTWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVKNTLIECRGEWSAEKYAANQKIMSNLWNEIAELADFNKDGEVTVEEFKQAVQKHCNGKPFGDFPSAFKTFIANQFKTIDVNGDGLVGVDEYRLDCISRSAFSCIKEIDDAYNLLCTEEDKKAGGINIARYQELYAQFISNPDEKCNAVYLFGPLKEVV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GEWSAEK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Crangon crangon | Crangon crangon | ACR43475 |
491138 |
| Cyprinodon variegatus | Cyprinodon variegatus | XP_015235421 XP_015235420 XP_015235419 |
28743 |
| Larimichthys crocea | Large yellow croaker | XP_010751502 XP_010751501 XP_010751500 KKF24908 |
215358 |
| Mycosphaerella eumusae | Mycosphaerella eumusae | KXS99260 |
321146 |
| Neodiprion lecontei | Redheaded pine sawfly | XP_015518563 |
441921 |
| Poecilia formosa | Amazon molly | XP_007557807 XP_007557806 XP_007557805 XP_007557804 |
48698 |
| Poecilia latipinna | Sailfin molly | XP_014897309 XP_014897308 XP_014897306 |
48699 |
| Poecilia mexicana | Poecilia mexicana | XP_014823465 XP_014823463 XP_014823461 |
48701 |
| Poecilia reticulata | Guppy | XP_008415581 XP_008415580 XP_008415577 |
8081 |
| Populus euphratica | Populus euphratica | XP_011030627 |
75702 |
| Populus trichocarpa | Black cottonwood | XP_002315750 |
3694 |
| Selaginella moellendorffii | Selaginella moellendorffii | XP_002986336 |
88036 |
| Xiphophorus maculatus | Southern platyfish | XP_014330229 |
8083 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.