If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: MAYTWDNR
Peptide within the protein Cra-c-4:
MAYTWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVKNTLIECRGEWSAEKYAANQKIMSNLWNEIAELADFNKDGEVTVEEFKQAVQKHCNGKPFGDFPSAFKTFIANQFKTIDVNGDGLVGVDEYRLDCISRSAFSCIKEIDDAYNLLCTEEDKKAGGINIARYQELYAQFISNPDEKCNAVYLFGPLKEVV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide MAYTWDNR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Amyelois transitella | Amyelois transitella | XP_013195555 |
680683 |
| Crangon crangon | Crangon crangon | ACR43475 |
491138 |
| Danaus plexippus | Monarch butterfly | EHJ67868 |
13037 |
| Marsupenaeus japonicus | Marsupenaeus japonicus | BAL72726 |
27405 |
| Plutella xylostella | Diamondback moth | XP_011554475 XP_011554474 |
51655 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.