If you found this site useful, please cite:

Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.

Peptide: NTLIECR

Peptide within the protein Cra-c-4:

MAYTWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVKNTLIECRGEWSAEKYAANQKIMSNLWNEIAELADFNKDGEVTVEEFKQAVQKHCNGKPFGDFPSAFKTFIANQFKTIDVNGDGLVGVDEYRLDCISRSAFSCIKEIDDAYNLLCTEEDKKAGGINIARYQELYAQFISNPDEKCNAVYLFGPLKEVV

References reporting this peptide:

None.


Species Uniqueness

Species containing the peptide NTLIECR are presented below. Accessions and taxid values link to further information hosted on NCBI.

Species name Common name Accession(s) Tax ID
Crangon crangon Crangon crangon ACR43475
491138

BLAST non-redundant protein database version: 4, date: December 9, 2015.

See the About page for more information.