If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: SAFSCIK
Peptide within the protein Cra-c-4:
MAYTWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVKNTLIECRGEWSAEKYAANQKIMSNLWNEIAELADFNKDGEVTVEEFKQAVQKHCNGKPFGDFPSAFKTFIANQFKTIDVNGDGLVGVDEYRLDCISRSAFSCIKEIDDAYNLLCTEEDKKAGGINIARYQELYAQFISNPDEKCNAVYLFGPLKEVV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide SAFSCIK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Bodo saltans | Bodo saltans | CUF00217 |
75058 |
| Crangon crangon | Crangon crangon | ACR43475 |
491138 |
| Schistosoma haematobium | Schistosoma haematobium | XP_012802770 |
6185 |
| Schistosoma mansoni | Schistosoma mansoni | CCD75253 |
6183 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.