If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: TFIANQFK
Peptide within the protein Cra-c-4:
MAYTWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVKNTLIECRGEWSAEKYAANQKIMSNLWNEIAELADFNKDGEVTVEEFKQAVQKHCNGKPFGDFPSAFKTFIANQFKTIDVNGDGLVGVDEYRLDCISRSAFSCIKEIDDAYNLLCTEEDKKAGGINIARYQELYAQFISNPDEKCNAVYLFGPLKEVV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide TFIANQFK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Crangon crangon | Crangon crangon | ACR43475 |
491138 |
| Eriocheir sinensis | Chinese mitten crab | AJG01359 |
95602 |
| Procambarus clarkii | Red swamp crayfish | ABB58783 AEG79567 |
6728 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.