If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: YQELYAQFISNPDEK
Peptide within the protein Cra-c-4:
MAYTWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVKNTLIECRGEWSAEKYAANQKIMSNLWNEIAELADFNKDGEVTVEEFKQAVQKHCNGKPFGDFPSAFKTFIANQFKTIDVNGDGLVGVDEYRLDCISRSAFSCIKEIDDAYNLLCTEEDKKAGGINIARYQELYAQFISNPDEKCNAVYLFGPLKEVV
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide YQELYAQFISNPDEK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Crangon crangon | Crangon crangon | ACR43475 |
491138 |
| Eriocheir sinensis | Chinese mitten crab | AJG01361 AJG01360 AJG01359 |
95602 |
| Palaemonetes varians | Atlantic ditch shrimp | ACR54113 |
647170 |
| Scylla paramamosain | Green mud crab | AFJ80778 |
85552 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.