If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AELEPILR
Peptide within the protein Cra-c-5:
MAADLSARDVERVKFAFSIYDFEGNGQIDAFYIGDCLRALNLNPTLALIAKLGGTEKRKEKMIKLDDFMPLFAQVKKDKDAGSYEDFIEVLKLYDKAENGTMMYAELEHILLSLGERLDKAELEPILRECCPPEDDEGLIPFEPFVKKLTQLL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AELEPILR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Aspergillus nidulans FGSC A4 | Aspergillus nidulans fgsc a4 | XP_660232 |
227321 |
| Crangon crangon | Crangon crangon | ACR43477 |
491138 |
| Galerina marginata CBS 339.88 | Galerina marginata cbs 339.88 | KDR80061 |
685588 |
| Tuber melanosporum | Perigord truffle | XP_002841427 |
39416 |
| Tuber melanosporum Mel28 | Tuber melanosporum mel28 | XP_002841427 |
656061 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.