If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: AENGTMMYAELEHILLSLGER
Peptide within the protein Cra-c-5:
MAADLSARDVERVKFAFSIYDFEGNGQIDAFYIGDCLRALNLNPTLALIAKLGGTEKRKEKMIKLDDFMPLFAQVKKDKDAGSYEDFIEVLKLYDKAENGTMMYAELEHILLSLGERLDKAELEPILRECCPPEDDEGLIPFEPFVKKLTQLL
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide AENGTMMYAELEHILLSLGER are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Crangon crangon | Crangon crangon | ACR43477 |
491138 |
| Marsupenaeus japonicus | Marsupenaeus japonicus | ADD70028 |
27405 |
| Trichinella spiralis | Trichinella spiralis | KRY04456 |
6334 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.