If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: ALVPNISDWSR
Peptide within the protein Cra-c-8:
MSGSRKFFVGGNWKMNGDKAAIDGIVDFMKKGPLNPNTEVVVGCPQCYLSYTREKLPAEIGVAAQNCYKVAKGAFTGEISPAMVKDCGCEWVILGHSERRNVFNEPDQLISEKVGHALEAGLKVIPCIGEKLDERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTASPEQAQDVHAKLRQWLTENVSAEVAESCRIIYGGSVSPSNCAELAKMGDIDGFLVGGASLKPDFVTIINARG
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shellfish | Arc-s-8.0101 | 190816 |
| Shrimp | Cra-c-8.0101 | 491138 |
Species containing the peptide ALVPNISDWSR are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Archaeopotamobius sibiriensis | Archaeopotamobius sibiriensis | CAD29196 CAD29196 |
190816 |
| Cherax quadricarinatus | Cherax quadricarinatus | AEL23034 AEL23034 |
27406 |
| Crangon crangon | Crangon crangon | ACR43476 ACR43476 |
491138 |
| Eriocheir sinensis | Chinese mitten crab | ADN52396 ADN52396 |
95602 |
| Fenneropenaeus chinensis | Fenneropenaeus chinensis | ABB81879 ABB81879 |
139456 |
| Libinia emarginata | Portly spider crab | ACY45522 ACY45522 |
6807 |
| Procambarus clarkii | Red swamp crayfish | AEB54655 AEB54655 |
6728 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.