If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: DCGCEWVILGHSER
Peptide within the protein Cra-c-8:
MSGSRKFFVGGNWKMNGDKAAIDGIVDFMKKGPLNPNTEVVVGCPQCYLSYTREKLPAEIGVAAQNCYKVAKGAFTGEISPAMVKDCGCEWVILGHSERRNVFNEPDQLISEKVGHALEAGLKVIPCIGEKLDERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTASPEQAQDVHAKLRQWLTENVSAEVAESCRIIYGGSVSPSNCAELAKMGDIDGFLVGGASLKPDFVTIINARG
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shellfish | Arc-s-8.0101 | 190816 |
| Shrimp | Cra-c-8.0101 | 491138 |
Species containing the peptide DCGCEWVILGHSER are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Hymenolepis microstoma | Hymenolepis microstoma | CDS29962 CDS29962 |
85433 |
| Archaeopotamobius sibiriensis | Archaeopotamobius sibiriensis | CAD29196 CAD29196 |
190816 |
| Armadillidium vulgare | Common pillbug | ACY45500 ACY45500 |
13347 |
| Cherax quadricarinatus | Cherax quadricarinatus | AEL23034 AEL23034 |
27406 |
| Crangon crangon | Crangon crangon | ACR43476 ACR43476 |
491138 |
| Echinococcus granulosus | Echinococcus granulosus | EUB56511 EUB56511 |
6210 |
| Echinococcus multilocularis | Echinococcus multilocularis | CDS36936 CDS36936 |
6211 |
| Eriocheir sinensis | Chinese mitten crab | ADN52396 ADN52396 |
95602 |
| Eurytemora affinis | Eurytemora affinis | ACY45509 ACY45509 |
88015 |
| Fasciola hepatica | Liver fluke | AGJ83762 AGJ83762 |
6192 |
| Fenneropenaeus chinensis | Fenneropenaeus chinensis | ABB81879 ABB81879 |
139456 |
| Lineus viridis | Lineus viridis | AAZ30657 AAZ30657 |
56195 |
| Litopenaeus vannamei | Pacific white shrimp | AFT92034 AFT92034 |
6689 |
| Neogonodactylus oerstedii | Neogonodactylus oerstedii | ACY45529 ACY45529 |
85128 |
| Procambarus clarkii | Red swamp crayfish | AEB54655 AEB54655 |
6728 |
| Taenia saginata | Beef tapeworm | OCK35149 OCK35149 |
6206 |
| Taenia solium | Pork tapeworm | Q9GTX8 Q9GTX8 |
6204 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.