If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: GAFTGEISPAMVK
Peptide within the protein Cra-c-8:
MSGSRKFFVGGNWKMNGDKAAIDGIVDFMKKGPLNPNTEVVVGCPQCYLSYTREKLPAEIGVAAQNCYKVAKGAFTGEISPAMVKDCGCEWVILGHSERRNVFNEPDQLISEKVGHALEAGLKVIPCIGEKLDERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTASPEQAQDVHAKLRQWLTENVSAEVAESCRIIYGGSVSPSNCAELAKMGDIDGFLVGGASLKPDFVTIINARG
References reporting this peptide:
None.
Species Uniqueness
Species containing the peptide GAFTGEISPAMVK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Crangon crangon | Crangon crangon | ACR43476 |
491138 |
| Fenneropenaeus chinensis | Fenneropenaeus chinensis | ABB81879 |
139456 |
| Litopenaeus vannamei | Pacific white shrimp | AFT92034 |
6689 |
| Picoides pubescens | Downy woodpecker | XP_009897916 |
118200 |
| Sinocyclocheilus rhinocerous | Sinocyclocheilus rhinocerous | XP_016393160 |
307959 |
| Trichopoda pennipes | Trichopoda pennipes | AKD14856 AKE48158 |
1640944 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.