If you found this site useful, please cite:
Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Peptide: VIPCIGEK
Peptide within the protein Cra-c-8:
MSGSRKFFVGGNWKMNGDKAAIDGIVDFMKKGPLNPNTEVVVGCPQCYLSYTREKLPAEIGVAAQNCYKVAKGAFTGEISPAMVKDCGCEWVILGHSERRNVFNEPDQLISEKVGHALEAGLKVIPCIGEKLDERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTASPEQAQDVHAKLRQWLTENVSAEVAESCRIIYGGSVSPSNCAELAKMGDIDGFLVGGASLKPDFVTIINARG
References reporting this peptide:
None.
Species Uniqueness
Warning: nonspecific peptide
| Food | Protein | Taxid |
|---|---|---|
| Shellfish | Arc-s-8.0101 | 190816 |
| Shrimp | Cra-c-8.0101 | 491138 |
Species containing the peptide VIPCIGEK are presented below. Accessions and taxid values link to further information hosted on NCBI.
| Species name | Common name | Accession(s) | Tax ID |
|---|---|---|---|
| Archaeopotamobius sibiriensis | Archaeopotamobius sibiriensis | CAD29196 CAD29196 |
190816 |
| Armadillidium vulgare | Common pillbug | ACY45500 ACY45500 |
13347 |
| Buccinum sp. JV-2012 | Buccinum sp. jv-2012 | AEZ54228 AEZ54228 |
1138812 |
| Cherax quadricarinatus | Cherax quadricarinatus | AEL23034 AEL23034 |
27406 |
| Ciona intestinalis | Vase tunicate | XP_002130790 XP_002130790 |
7719 |
| Crangon crangon | Crangon crangon | ACR43476 ACR43476 |
491138 |
| Daphnia magna | Daphnia magna | ACY45508 KZS06051 JAN39115 ACY45508 KZS06051 JAN39115 |
35525 |
| Eriocheir sinensis | Chinese mitten crab | ADN52396 ADN52396 |
95602 |
| Fenneropenaeus chinensis | Fenneropenaeus chinensis | ABB81879 ABB81879 |
139456 |
| Libinia emarginata | Portly spider crab | ACY45522 ACY45522 |
6807 |
| Lichtheimia corymbifera JMRC:FSU:9682 | Lichtheimia corymbifera jmrc:fsu:9682 | CDH51135 CDH51134 CDH51135 CDH51134 |
1263082 |
| Lichtheimia ramosa | Lichtheimia ramosa | CDS12634 CDS12634 |
688394 |
| Litopenaeus vannamei | Pacific white shrimp | AFT92034 AFT92034 |
6689 |
| Metajapyx subterraneus | Metajapyx subterraneus | ACY45520 ACY45520 |
109748 |
| Mus musculus | House mouse | EDL05032 EDL05032 |
10090 |
| Nebalia hessleri | Nebalia hessleri | ABV81291 ABV81291 |
85135 |
| Neogonodactylus oerstedii | Neogonodactylus oerstedii | ACY45529 ACY45529 |
85128 |
| Neptunea sp. JV-2012 | Neptunea sp. jv-2012 | AEZ54227 AEZ54227 |
1138818 |
| Procambarus clarkii | Red swamp crayfish | AEB54655 AEB54655 |
6728 |
BLAST non-redundant protein database version: 4, date: December 9, 2015.
See the About page for more information.