Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
North-sea-shrimp Protein: Cra c 8 | Triosephosphate Isomerase
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 249 amino acids
MSGSRKFFVGGNWKMNGDKAAIDGIVDFMKKGPLNPNTEVVVGCPQCYLSYTREKLPAEIGVAAQNCYKVAKGAFTGEISPAMVKDCGCEWVILGHSERRNVFNEPDQLISEKVGHALEAGLKVIPCIGEKLDERESNRTEEVVFAQMKALVPNISDWSRVVIAYEPVWAIGTGKTASPEQAQDVHAKLRQWLTENVSAEVAESCRIIYGGSVSPSNCAELAKMGDIDGFLVGGASLKPDFVTIINARG
UniProt: D7F1Q0 IUIS: Cra c 8Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| K | FFVGGNWK | M | 0 | 0.389 | 0.41518 |
| K | AAIDGIVDFMK | K | 0 | 0.461 | 0.41538 |
| K | GPLNPNTEVVVGCPQCYLSYTR | E | 0 | 0.642 | 0.15448 |
| K | LPAEIGVAAQNCYK | V | 0 | 0.627 | 0.87442 |
| K | GAFTGEISPAMVK | D | 0 | 0.592 | 0.87682 |
| K | DCGCEWVILGHSER | R | 0 | 0.505 | 0.19444 |
| R | NVFNEPDQLISEK | V | 0 | 0.692 | 0.8156 |
| K | VGHALEAGLK | V | 0 | 0.462 | 0.60172 |
| K | VIPCIGEK | L | 0 | 0.259 | 0.55844 |
| R | TEEVVFAQMK | A | 0 | 0.337 | 0.45812 |
| K | ALVPNISDWSR | V | 0 | 0.651 | 0.77196 |
| R | VVIAYEPVWAIGTGK | T | 0 | 0.501 | 0.4364 |
| K | TASPEQAQDVHAK | L | 0 | 0.506 | 0.3352 |
| R | QWLTENVSAEVAESCR | I | 0 | 0.482 | 0.42706 |
| R | IIYGGSVSPSNCAELAK | M | 0 | 0.663 | 0.6362 |
| K | MGDIDGFLVGGASLKPDFVTIINAR | G | 0 | 0.395 | 0.04414 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.